P29555 · ABDA_DROME
- ProteinHomeobox protein abdominal-A
- Geneabd-A
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids590 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Required for segmental identity of the second through eighth abdominal segments. Once a pattern of abd-A expression is turned on in a given parasegment, it remains on the more posterior parasegment, so that the complex pattern of expression is built up in the successive parasegments. Appears to repress expression of Ubx whenever they appear in the same cell, but abd-A is repressed by Abd-B only in the eight and ninth abdominal segments.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 398-457 | Homeobox | ||||
Sequence: RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein abdominal-A
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP29555
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000200249 | 1-590 | Homeobox protein abdominal-A | |||
Sequence: MSKFVFDSMLPKYPQFQPFISSHHLTTTPPNSSSAAVAAALAAAAASASASVSASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIGGGLGGNLGMMSALDKSNHDLLKAVSKVNS |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 53-141 | Polar residues | ||||
Sequence: SASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHL | ||||||
Region | 53-154 | Disordered | ||||
Sequence: SASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSS | ||||||
Region | 187-230 | Disordered | ||||
Sequence: LLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASAS | ||||||
Compositional bias | 188-230 | Polar residues | ||||
Sequence: LTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASAS | ||||||
Motif | 368-373 | Antp-type hexapeptide | ||||
Sequence: RYPWMT | ||||||
Region | 468-525 | Disordered | ||||
Sequence: RRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHSIIA | ||||||
Compositional bias | 481-522 | Polar residues | ||||
Sequence: ETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHS |
Sequence similarities
Belongs to the Antp homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P29555-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameAbd-A2
- SynonymsABD-AII, B
- Length590
- Mass (Da)62,410
- Last updated1996-10-01 v2
- ChecksumFF080CC2D71ECA82
P29555-2
- NameAbd-A1
- SynonymsABD-AI, A
- Differences from canonical
- 1-260: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E1JIM9 | E1JIM9_DROME | abd-A | 330 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_002394 | 1-260 | in isoform Abd-A1 | |||
Sequence: Missing | ||||||
Compositional bias | 53-141 | Polar residues | ||||
Sequence: SASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHL | ||||||
Compositional bias | 188-230 | Polar residues | ||||
Sequence: LTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASAS | ||||||
Compositional bias | 481-522 | Polar residues | ||||
Sequence: ETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54453 EMBL· GenBank· DDBJ | CAA38321.1 EMBL· GenBank· DDBJ | mRNA | ||
U31961 EMBL· GenBank· DDBJ | AAA84405.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U31961 EMBL· GenBank· DDBJ | AAA84406.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF55359.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF55360.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT016031 EMBL· GenBank· DDBJ | AAV36916.1 EMBL· GenBank· DDBJ | mRNA |