P29351 · PTN6_MOUSE
- ProteinTyrosine-protein phosphatase non-receptor type 6
- GenePtpn6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids595 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
When recruited to immunoreceptor tyrosine-based inhibitory motif (ITIM)-containing receptors such as immunoglobulin-like transcript 2/LILRB1, programmed cell death protein 1/PDCD1, CD3D, CD22 and other receptors involved in immune regulation, initiates their dephosphorylation and subsequently inhibits downstream signaling events (PubMed:10026201, PubMed:33990399).
Modulates the signaling of several cytokine receptors including IL-4 receptor. Additionally, targets multiple cytoplasmic signaling molecules including STING1, LCK or STAT1 among others involved in diverse cellular processes including modulation of T-cell activation or cGAS-STING signaling. Within the nucleus, negatively regulates the activity of some transcription factors such as NFAT5 via direct dephosphorylation. Acts also as a key transcriptional regulator of hepatic gluconeogenesis by controlling recruitment of RNA polymerase II to the PCK1 promoter together with STAT5A
Catalytic activity
- H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 419 | substrate | ||||
Sequence: D | ||||||
Active site | 453 | Phosphocysteine intermediate | ||||
Sequence: C | ||||||
Binding site | 453-459 | substrate | ||||
Sequence: CSAGIGR | ||||||
Binding site | 500 | substrate | ||||
Sequence: Q |
GO annotations
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTyrosine-protein phosphatase non-receptor type 6
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP29351
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Involvement in disease
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 30-33 | Slight reduction in binding to phosphorylated Lilrb4a. | ||||
Sequence: RPSR → KPSE | ||||||
Natural variant | 77-99 | in motheaten (me) | ||||
Sequence: EYYTQQQGILQDRDGTIIHLKYP → VPRPHIWRAGGVTAAGQGRALD | ||||||
Natural variant | 100-595 | in motheaten (me) | ||||
Sequence: Missing | ||||||
Mutagenesis | 136 | Abolishes binding to phosphorylated Lilrb4a. | ||||
Sequence: R → K | ||||||
Mutagenesis | 482 | Mice display a low bone mass density and are associated with osteopenia and elevated inflammatory cytokines. | ||||
Sequence: I → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 39 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000094759 | 1-595 | Tyrosine-protein phosphatase non-receptor type 6 | |||
Sequence: MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK | ||||||
Modified residue | 10 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 57 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 64 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Cross-link | 308 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Modified residue | 377 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 394 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 536 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 564 | Phosphotyrosine; by LYN | ||||
Sequence: Y |
Post-translational modification
Phosphorylation at Tyr-564 by LYN enhances phosphatase activity. Phosphorylation at Thr-394 by TAOK3 leads to polyubiquitination and subsequent proteasomal degradation (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Interaction
Subunit
Interacts with MILR1 (tyrosine-phosphorylated) (PubMed:20526344).
Interacts with KIT (PubMed:9528781).
Interacts with SIRPA/PTPNS1 (PubMed:9712903).
Interacts with LILRB1 and LILRB2. Interacts with LILRB4. Interacts with FCRL2 and FCRL4. Interacts with FCRL3 and FCRL6 (tyrosine phosphorylated form). Interacts with CD84. Interacts with CD300LF (PubMed:14662855).
Interacts with CDK2. Interacts with KIR2DL1; the interaction is enhanced by ARRB2. Interacts (via SH2 1 domain) with ROS1; the interaction is direct and promotes ROS1 dephosphorylation. Interacts with EGFR; inhibits EGFR-dependent activation of MAPK/ERK. Interacts with the tyrosine phosphorylated form of PDPK1 (By similarity).
Interacts with CEACAM1 (via cytoplasmic domain); this interaction depends on the monomer/dimer equilibrium and is phosphorylation-dependent (PubMed:19948503, PubMed:9867848).
Interacts with MPIG6B (via ITIM motif) (PubMed:23112346).
Interacts with KLRI1 and KLRI2 (By similarity).
Interacts with moesin/MSN. Interacts with Lilrb4a (when tyrosine phosphorylated); the interaction enhances Lilrb4a-mediated inhibition of mast cell activation (PubMed:10026201, PubMed:9973385).
Interacts with CLEC12B (via ITIM motif). Interacts with polymerase II components POLR2C and POLR2J; these interactions recruit RNA polymerase II to the PCK1 promoter. Interacts with TNFRSF10A; this interaction enables the inhibition of T-cell receptor signaling via LCK (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P29351 | Camk1 Q91YS8 | 3 | EBI-2620699, EBI-911352 | |
BINARY | P29351 | Cd22 P35329 | 5 | EBI-2620699, EBI-300059 | |
BINARY | P29351 | Gab2 Q9Z1S8 | 2 | EBI-2620699, EBI-641738 | |
BINARY | P29351 | Stat1 P42225 | 2 | EBI-2620699, EBI-647118 | |
XENO | P29351 | tir B7UM99 | 2 | EBI-2620699, EBI-2504426 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-100 | SH2 1 | ||||
Sequence: WFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPL | ||||||
Domain | 110-213 | SH2 2 | ||||
Sequence: WYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPY | ||||||
Domain | 244-515 | Tyrosine-protein phosphatase | ||||
Sequence: FWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQF | ||||||
Region | 536-595 | Disordered | ||||
Sequence: YGNITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK | ||||||
Compositional bias | 554-589 | Basic and acidic residues | ||||
Sequence: RTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNK |
Domain
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P29351-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length595
- Mass (Da)67,559
- Last updated2002-07-11 v2
- ChecksumCF17300D032638D2
P29351-2
- Name2
- Differences from canonical
- 1-3: MVR → MLSRG
P29351-3
- Name3
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_005131 | 1-3 | in isoform 2 | |||
Sequence: MVR → MLSRG | ||||||
Alternative sequence | VSP_005132 | 1-39 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_005133 | 40-44 | in isoform 3 | |||
Sequence: SLSVR → MLSRG | ||||||
Sequence conflict | 240 | in Ref. 1; AAA37796 | ||||
Sequence: A → R | ||||||
Compositional bias | 554-589 | Basic and acidic residues | ||||
Sequence: RTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNK | ||||||
Sequence conflict | 572 | in Ref. 1; AAA37796 | ||||
Sequence: K → Q | ||||||
Sequence conflict | 586 | in Ref. 6; AAH12660 | ||||
Sequence: E → D |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M68902 EMBL· GenBank· DDBJ | AAA37796.1 EMBL· GenBank· DDBJ | mRNA | ||
M90389 EMBL· GenBank· DDBJ | AAA40007.1 EMBL· GenBank· DDBJ | mRNA | ||
S63763 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
S63764 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
S63803 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AC002397 EMBL· GenBank· DDBJ | AAC36009.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC002397 EMBL· GenBank· DDBJ | AAC36008.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65955 EMBL· GenBank· DDBJ | AAD00152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65952 EMBL· GenBank· DDBJ | AAD00152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65953 EMBL· GenBank· DDBJ | AAD00152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65954 EMBL· GenBank· DDBJ | AAD00152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65955 EMBL· GenBank· DDBJ | AAD00151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65951 EMBL· GenBank· DDBJ | AAD00151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65952 EMBL· GenBank· DDBJ | AAD00151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65953 EMBL· GenBank· DDBJ | AAD00151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U65954 EMBL· GenBank· DDBJ | AAD00151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC012660 EMBL· GenBank· DDBJ | AAH12660.1 EMBL· GenBank· DDBJ | mRNA |