P29191 · PG130_VACCW
- Protein39kDa core protein OPG130
- GeneOPG130
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids281 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the virion core. Participates in virion assembly.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum-Golgi intermediate compartment membrane | |
Cellular Component | membrane | |
Cellular Component | virion component |
Names & Taxonomy
Protein names
- Recommended name39kDa core protein OPG130
- Short namesp39
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Nucleocytoviricota > Pokkesviricetes > Chitovirales > Poxviridae > Chordopoxvirinae > Orthopoxvirus > Vaccinia virus
- Virus hosts
Accessions
- Primary accessionP29191
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes between the core and the membrane; might surround the outer core wall like a palisade (spikes).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000099219 | 1-281 | 39kDa core protein OPG130 | |||
Sequence: MDFFNKFSQGLAESSTPKSSIYYSEEKDPDTKKDEAIEIGLKSQESYYQRQLREQLARDNMTVASRQPIQPLQPTIHITPQPVPTATPAPILLPSSTVPTPKPRQQTNTSSDMSNLFDWLSEDTDAPASSLLPALTPSNAVQDIISKFNKDQKTTTPPSTQPSQTLPTTTCTQQSDGNISCTTPTVTPPQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMALKDLMSNVERDMHQLQAETNDLVTNVYDAREYTRRAIDQILQLVKGFERFQK |
Post-translational modification
Its phosphorylation state is regulated by the OPG054 kinase and the OPG106 phosphatase.
Expression
Induction
Expressed in the late phase of the viral replicative cycle.
Keywords
- Developmental stage
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-33 | Disordered | ||||
Sequence: MDFFNKFSQGLAESSTPKSSIYYSEEKDPDTKK | ||||||
Compositional bias | 8-22 | Polar residues | ||||
Sequence: SQGLAESSTPKSSIY | ||||||
Region | 93-112 | Disordered | ||||
Sequence: LPSSTVPTPKPRQQTNTSSD | ||||||
Compositional bias | 98-112 | Polar residues | ||||
Sequence: VPTPKPRQQTNTSSD | ||||||
Compositional bias | 149-184 | Polar residues | ||||
Sequence: NKDQKTTTPPSTQPSQTLPTTTCTQQSDGNISCTTP | ||||||
Region | 149-188 | Disordered | ||||
Sequence: NKDQKTTTPPSTQPSQTLPTTTCTQQSDGNISCTTPTVTP |
Sequence similarities
Belongs to the orthopoxvirus OPG130 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length281
- Mass (Da)30,927
- Last updated1992-12-01 v1
- Checksum124AE6E52CB70BAE
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 8-22 | Polar residues | ||||
Sequence: SQGLAESSTPKSSIY | ||||||
Compositional bias | 98-112 | Polar residues | ||||
Sequence: VPTPKPRQQTNTSSD | ||||||
Compositional bias | 149-184 | Polar residues | ||||
Sequence: NKDQKTTTPPSTQPSQTLPTTTCTQQSDGNISCTTP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M76473 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AY243312 EMBL· GenBank· DDBJ | AAO89402.1 EMBL· GenBank· DDBJ | Genomic DNA |