P29084 · T2EB_HUMAN
- ProteinTranscription initiation factor IIE subunit beta
- GeneGTF2E2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids291 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 66-146 | TFIIE beta | ||||
Sequence: ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | transcription factor TFIID complex | |
Cellular Component | transcription factor TFIIE complex | |
Molecular Function | DNA binding | |
Molecular Function | RNA binding | |
Molecular Function | RNA polymerase II general transcription initiation factor activity | |
Biological Process | transcription by RNA polymerase II | |
Biological Process | transcription initiation at RNA polymerase II promoter |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
The subsequence SSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKK, which contains the TFIIE_beta domain, shows transcriptional activator activity in a high-throughput recruitment assay.
Names & Taxonomy
Protein names
- Recommended nameTranscription initiation factor IIE subunit beta
- Short namesTFIIE-beta
- Alternative names
Gene names
- Community suggested namesGTF2E2
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP29084
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Trichothiodystrophy 6, non-photosensitive (TTD6)
- Note
- DescriptionA form of trichothiodystrophy, a disease characterized by sulfur-deficient brittle hair and multisystem variable abnormalities. The spectrum of clinical features varies from mild disease with only hair involvement to severe disease with cutaneous, neurologic and profound developmental defects. Ichthyosis, intellectual and developmental disabilities, decreased fertility, abnormal characteristics at birth, ocular abnormalities, short stature, and infections are common manifestations. There are both photosensitive and non-photosensitive forms of the disorder. TTD6 patients do not manifest cutaneous photosensitivity. Inheritance pattern has been reported to be autosomal recessive.
- See alsoMIM:616943
Natural variants in TTD6
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_076893 | 150 | A>P | in TTD6; reduction in the levels of both TFIIE-alpha and TFIIE-beta subunits of the TFIIE complex in patient cells; reduced phosphorylation of TFIIE-alpha observed in patient cells; dbSNP:rs875989846 | |
VAR_076894 | 187 | D>Y | in TTD6; reduction in the levels of both TFIIE-alpha and TFIIE-beta subunits of the TFIIE complex in patient cells; reduced phosphorylation of TFIIE-alpha observed in patient cells; dbSNP:rs875989847 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_052281 | 133 | in dbSNP:rs2229299 | |||
Sequence: I → T | ||||||
Natural variant | VAR_076893 | 150 | in TTD6; reduction in the levels of both TFIIE-alpha and TFIIE-beta subunits of the TFIIE complex in patient cells; reduced phosphorylation of TFIIE-alpha observed in patient cells; dbSNP:rs875989846 | |||
Sequence: A → P | ||||||
Natural variant | VAR_039003 | 183 | in dbSNP:rs2978277 | |||
Sequence: K → R | ||||||
Natural variant | VAR_076894 | 187 | in TTD6; reduction in the levels of both TFIIE-alpha and TFIIE-beta subunits of the TFIIE complex in patient cells; reduced phosphorylation of TFIIE-alpha observed in patient cells; dbSNP:rs875989847 | |||
Sequence: D → Y |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 268 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000211226 | 1-291 | UniProt | Transcription initiation factor IIE subunit beta | |||
Sequence: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK | |||||||
Modified residue (large scale data) | 18 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 19 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 58 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 61 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 61 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 74 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 227 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 289 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Tetramer of two alpha and two beta chains (PubMed:1956398).
Interacts with FACT subunit SUPT16H (PubMed:10792464).
Interacts with ATF7IP (PubMed:19106100).
Interacts with SND1 (PubMed:7651391).
Part of TBP-based Pol II pre-initiation complex (PIC), in which Pol II core assembles with general transcription factors and other specific initiation factors including GTF2E1, GTF2E2, GTF2F1, GTF2F2, TCEA1, ERCC2, ERCC3, GTF2H2, GTF2H3, GTF2H4, GTF2H5, GTF2A1, GTF2A2, GTF2B and TBP; this large multi-subunit PIC complex mediates DNA unwinding and targets Pol II core to the transcription start site where the first phosphodiester bond forms
Interacts with FACT subunit SUPT16H (PubMed:10792464).
Interacts with ATF7IP (PubMed:19106100).
Interacts with SND1 (PubMed:7651391).
Part of TBP-based Pol II pre-initiation complex (PIC), in which Pol II core assembles with general transcription factors and other specific initiation factors including GTF2E1, GTF2E2, GTF2F1, GTF2F2, TCEA1, ERCC2, ERCC3, GTF2H2, GTF2H3, GTF2H4, GTF2H5, GTF2A1, GTF2A2, GTF2B and TBP; this large multi-subunit PIC complex mediates DNA unwinding and targets Pol II core to the transcription start site where the first phosphodiester bond forms
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P29084 | EXOC8 Q8IYI6 | 5 | EBI-2853321, EBI-742102 | |
BINARY | P29084 | GTF2E1 P29083 | 8 | EBI-2853321, EBI-5462215 | |
BINARY | P29084 | KAT5 Q92993 | 3 | EBI-2853321, EBI-399080 | |
BINARY | P29084 | MCC P23508 | 2 | EBI-2853321, EBI-307531 | |
BINARY | P29084 | PICK1 Q9NRD5 | 3 | EBI-2853321, EBI-79165 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-20 | Basic and acidic residues | ||||
Sequence: MDPSLLRERELFKKRALSTP | ||||||
Region | 1-63 | Disordered | ||||
Sequence: MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFN | ||||||
Compositional bias | 47-63 | Polar residues | ||||
Sequence: GSSGSKQNSDHSNGSFN | ||||||
Region | 243-272 | Disordered | ||||
Sequence: SSMQESGPKKVAPIQRRKKPASQKKRRFKT | ||||||
Compositional bias | 255-272 | Basic residues | ||||
Sequence: PIQRRKKPASQKKRRFKT |
Sequence similarities
Belongs to the TFIIE beta subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length291
- Mass (Da)33,044
- Last updated1992-12-01 v1
- Checksum20F6BDFF2E06E5E7
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-20 | Basic and acidic residues | ||||
Sequence: MDPSLLRERELFKKRALSTP | ||||||
Compositional bias | 47-63 | Polar residues | ||||
Sequence: GSSGSKQNSDHSNGSFN | ||||||
Sequence conflict | 53 | in Ref. 3; AAG39077 | ||||
Sequence: Q → E | ||||||
Compositional bias | 255-272 | Basic residues | ||||
Sequence: PIQRRKKPASQKKRRFKT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S67861 EMBL· GenBank· DDBJ | AAB20414.1 EMBL· GenBank· DDBJ | mRNA | ||
X63469 EMBL· GenBank· DDBJ | CAA45069.1 EMBL· GenBank· DDBJ | mRNA | ||
AF292062 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292056 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292057 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292058 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292059 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292060 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF292061 EMBL· GenBank· DDBJ | AAG39077.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471080 EMBL· GenBank· DDBJ | EAW63446.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471080 EMBL· GenBank· DDBJ | EAW63449.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC030572 EMBL· GenBank· DDBJ | AAH30572.1 EMBL· GenBank· DDBJ | mRNA |