P29006 · BMNL1_BOMVA
- ProteinBombinin-like peptides 1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids137 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Has antimicrobial activity, but no hemolytic activity. Preliminary evidence indicates that this peptide does not lyse and thus kill the bacteria by its antimicrobial activity.
Bombinin H has antibacterial and hemolytic activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | defense response to bacterium | |
Biological Process | killing of cells of another organism |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameBombinin-like peptides 1
- Cleaved into 5 chains
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Bombinatoridae > Bombina
Accessions
- Primary accessionP29006
Subcellular Location
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 117 | |||||
Sequence: I → L | ||||||
Natural variant | 124 | |||||
Sequence: L → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MNFKYIVAVSILIASAYA | ||||||
Peptide | PRO_0000003067 | 19-43 | Acidic peptide 1-1 | |||
Sequence: RSEENDIQSLSQRDVLEEESLREIR | ||||||
Peptide | PRO_0000003068 | 44-70 | Bombinin-like peptide 1 | |||
Sequence: GIGGALLSAAKVGLKGLAKGLAEHFAN | ||||||
Modified residue | 70 | Asparagine amide | ||||
Sequence: N | ||||||
Peptide | PRO_0000003069 | 74-81 | Octapeptide 1 | |||
Sequence: TAEEREVM | ||||||
Peptide | PRO_0000003070 | 84-114 | Acidic peptide 1-2 | |||
Sequence: LEAAMRDLDSFEHPEEASEKETRGFNQEEKE | ||||||
Peptide | PRO_0000003071 | 117-136 | Bombinin-H | |||
Sequence: IIGPVLGLVGSALGGLLKKI | ||||||
Modified residue | 118 | D-allo-isoleucine | ||||
Sequence: I | ||||||
Modified residue | 136 | Isoleucine amide | ||||
Sequence: I |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the skin glands.
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 91-112 | Disordered | ||||
Sequence: LDSFEHPEEASEKETRGFNQEE |
Sequence similarities
Belongs to the bombinin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length137
- Mass (Da)14,982
- Last updated1992-12-01 v1
- Checksum3EC3EF6E47CA1F92
Keywords
- Technical term