P28939 · ICP27_EHV1B
- ProteinmRNA export factor ICP27 homolog
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids470 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Multifunctional regulator of the expression of viral genes that mediates nuclear export of viral intronless mRNAs. This immediate early (EI) protein promotes the nuclear export of viral intronless mRNAs by interacting with mRNAs and host NXF1/TAP (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | RNA binding | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namemRNA export factor ICP27 homolog
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Alphaherpesvirinae > Varicellovirus > Varicellovirus equidalpha1 > Equid alphaherpesvirus 1
- Virus hosts
Accessions
- Primary accessionP28939
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between the nucleus and the cytoplasm.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000115826 | 1-470 | mRNA export factor ICP27 homolog | |||
Sequence: MALSSVSSCEPMEDEMSIMGSDTEDNFTGGDTCAEATRGLVNKSAFVPTQTVGTVSALRNVVGDPPKSVVVSFSASPQRAQPSNPKSERPAFGHGRRNRRRPFRRNNWKQQQRGWEKPEPENVPARQSAGSWPKRSSLPVHMRLGQRGGDSSSADSGHGGAGPSDRWRFKTRTQSVARVHRNRRRGNANHGSNTPGRSAGDRLNAAAASSIADVCRRVTSSRIGEMFHGARETLTTPVKNGGFRAENSSPWAPVLGFGSDQFNPEARRITWDTLVEHGVNLYKLFEVRSHAAEAARSLRDAVMRGENLLEALASADETLSWCKMIVTKNLPMRTRDPIISSSVALLDNLRLKLEPFMRCYLSSSGSPTLAELCDHQRLSDVACVPTFMFVMLARIARAVGSGAETVSRDALGPDGRVLADYVPGACLAGTLEAIDAHKRRCKADTCSLVSAYTLVPVYLHGKYFYCNQIF |
Expression
Keywords
- Developmental stage
Interaction
Subunit
Homodimer. Homodimerization is required for transactivation. Associates in a complex with RNA, and host export factors NXF1/TAP and ALYREF; these interactions allow nuclear export of viral transcripts. Interacts with three host shuttling SR proteins SRSF1, SRSF3 and SRSF7. Interacts with host SRPK1. Interacts with IE62; this interaction enhances IE62 transactivation (By similarity).
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MALSSVSSCEPMEDEMSIMGSDTEDNFTGGD | ||||||
Region | 62-204 | Disordered | ||||
Sequence: VGDPPKSVVVSFSASPQRAQPSNPKSERPAFGHGRRNRRRPFRRNNWKQQQRGWEKPEPENVPARQSAGSWPKRSSLPVHMRLGQRGGDSSSADSGHGGAGPSDRWRFKTRTQSVARVHRNRRRGNANHGSNTPGRSAGDRLN | ||||||
Compositional bias | 71-85 | Polar residues | ||||
Sequence: VSFSASPQRAQPSNP | ||||||
Compositional bias | 93-107 | Basic residues | ||||
Sequence: GHGRRNRRRPFRRNN | ||||||
Compositional bias | 173-187 | Basic residues | ||||
Sequence: TQSVARVHRNRRRGN | ||||||
Zinc finger | 359-446 | CHC2-type | ||||
Sequence: CYLSSSGSPTLAELCDHQRLSDVACVPTFMFVMLARIARAVGSGAETVSRDALGPDGRVLADYVPGACLAGTLEAIDAHKRRCKADTC |
Domain
Binds viral intronless RNAs and SR proteins through the Arg-rich region.
Sequence similarities
Belongs to the HHV-1 ICP27 protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length470
- Mass (Da)51,321
- Last updated1992-12-01 v1
- Checksum99AC5258EFB74B0E
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 71-85 | Polar residues | ||||
Sequence: VSFSASPQRAQPSNP | ||||||
Compositional bias | 93-107 | Basic residues | ||||
Sequence: GHGRRNRRRPFRRNN | ||||||
Compositional bias | 173-187 | Basic residues | ||||
Sequence: TQSVARVHRNRRRGN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY665713 EMBL· GenBank· DDBJ | AAT67262.1 EMBL· GenBank· DDBJ | Genomic DNA |