P28846 · RIR1_EHV1B
- ProteinRibonucleoside-diphosphate reductase large subunit
- GeneRIR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids790 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Catalytic activity
- [thioredoxin]-disulfide + a 2'-deoxyribonucleoside 5'-diphosphate + H2O = [thioredoxin]-dithiol + a ribonucleoside 5'-diphosphate
RHEA-COMP:10700 CHEBI:50058 Position: n/n+3+ CHEBI:73316 + CHEBI:15377 = RHEA-COMP:10698 CHEBI:29950 Position: nCHEBI:29950 Position: n+3+ CHEBI:57930
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 208 | substrate | ||||
Sequence: T | ||||||
Binding site | 223-224 | substrate | ||||
Sequence: SC | ||||||
Site | 224 | Important for hydrogen atom transfer | ||||
Sequence: C | ||||||
Binding site | 254 | substrate | ||||
Sequence: G | ||||||
Active site | 436 | Proton acceptor | ||||
Sequence: N | ||||||
Binding site | 436-440 | substrate | ||||
Sequence: NLCTE | ||||||
Active site | 438 | Cysteine radical intermediate | ||||
Sequence: C | ||||||
Active site | 440 | Proton acceptor | ||||
Sequence: E | ||||||
Site | 453 | Important for hydrogen atom transfer | ||||
Sequence: C | ||||||
Binding site | 621-625 | substrate | ||||
Sequence: PTVSS | ||||||
Site | 765 | Important for electron transfer | ||||
Sequence: Y | ||||||
Site | 766 | Important for electron transfer | ||||
Sequence: Y | ||||||
Site | 785 | Interacts with thioredoxin/glutaredoxin | ||||
Sequence: C | ||||||
Site | 788 | Interacts with thioredoxin/glutaredoxin | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ribonucleoside-diphosphate reductase complex | |
Molecular Function | ATP binding | |
Molecular Function | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor | |
Biological Process | deoxyribonucleotide biosynthetic process | |
Biological Process | DNA replication | |
Biological Process | release from viral latency |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibonucleoside-diphosphate reductase large subunit
- EC number
- Short namesR1
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Alphaherpesvirinae > Varicellovirus > Varicellovirus equidalpha1 > Equid alphaherpesvirus 1
- Virus hosts
Accessions
- Primary accessionP28846
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000187241 | 1-790 | Ribonucleoside-diphosphate reductase large subunit | |||
Sequence: MALNFLQSDCPLAIIQDVISRVDAISDYGYANELSTTLPPRPSRSQVLEYITRVVDTLKPRCRVDERLYVVCGELVHLRIRTRNVEDLKYWLNSTEIALNEIVEKDILDHLDFIQRTLHAFESSEYRELCALGLQSALKYEEMYLAKMRGGRIESMGQFFLRLATTATHYTMEEPAMARVLVSGEVGWTYIFKAYFTALAGQVLIPATPIMLFGGRDCGSLASCYLLNPRVTDMNSAMLALMEEAGPILCNRGGIGLSLQRFNTPPKEGCSRGVMALLKLIDSMTMAINSDGERPTGVCVYFEPWHADIRAILNMRGMLARDETVRCDNIFACMWTPDLFFDRYQRYLDGESGVMWTLFDDTASHLCHMYGKEFEEEYERLEQCGFGVDSIPIQDMAFIIVRSAVMTGSPFLMFKDACNKHYHFDLRRKGAIMGSNLCTEIIQHADETQNGVCNLASINLPKCLAIPPPHTAGVPYFDFAALGRAAATATIFVNSMMRAGTYPTVKSQRGVDENRSLGLGIQGLHTAFLMLDLDMASPEARQLNKQIAERLLLNSMKASATLCRLGMKPFKGFEDSKYSLGELPFDSYPGVTLANRNAWRRLRTEIKQHGLYNSQFVAYMPTVSSSQVTESSEGFSPVYTNLFSKVTATGEVLRPNLLLMRTIRSIFPRECARLQALSTLEMAQWSVVGAFGDLPVGHPLSKFKTAFEYDQRTLIDMCADRAPFVDQSQSMSLFITEPADGKLPASKIMSLLVHAYKRGLKTGMYYCKIKKATNNGVFVGGDLVCTSCSL | ||||||
Disulfide bond | 224↔453 | Redox-active | ||||
Sequence: CYLLNPRVTDMNSAMLALMEEAGPILCNRGGIGLSLQRFNTPPKEGCSRGVMALLKLIDSMTMAINSDGERPTGVCVYFEPWHADIRAILNMRGMLARDETVRCDNIFACMWTPDLFFDRYQRYLDGESGVMWTLFDDTASHLCHMYGKEFEEEYERLEQCGFGVDSIPIQDMAFIIVRSAVMTGSPFLMFKDACNKHYHFDLRRKGAIMGSNLCTEIIQHADETQNGVC |
Keywords
- PTM
Expression
Keywords
- Developmental stage
Interaction
Subunit
Heterotetramer composed of a homodimer of the large subunit (R1) and a homodimer of the small subunit (R2). Larger multisubunit protein complex are also active, composed of (R1)n(R2)n.
Sequence
- Sequence statusComplete
- Length790
- Mass (Da)88,399
- Last updated1992-12-01 v1
- ChecksumD8A21677716F5844
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY665713 EMBL· GenBank· DDBJ | AAT67278.1 EMBL· GenBank· DDBJ | Genomic DNA |