P28068 · DMB_HUMAN
- ProteinHLA class II histocompatibility antigen, DM beta chain
- GeneHLA-DMB
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids263 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | late endosome membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | MHC class II protein complex | |
Molecular Function | MHC class II protein complex binding | |
Molecular Function | peptide antigen binding | |
Biological Process | adaptive immune response | |
Biological Process | antigen processing and presentation of exogenous peptide antigen via MHC class II | |
Biological Process | MHC class II protein complex assembly | |
Biological Process | peptide antigen assembly with MHC class II protein complex | |
Biological Process | positive regulation of immune response | |
Biological Process | positive regulation of T cell activation | |
Biological Process | positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell | |
Biological Process | positive regulation of T cell proliferation |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHLA class II histocompatibility antigen, DM beta chain
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP28068
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Late endosome membrane ; Single-pass type I membrane protein
Lysosome membrane ; Single-pass type I membrane protein
Note: Localizes to late endocytic compartment. Associates with lysosome membranes.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 19-218 | Lumenal | ||||
Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLK | ||||||
Transmembrane | 219-239 | Helical | ||||
Sequence: VSVSAVTLGLGLIIFSLGVIS | ||||||
Topological domain | 240-263 | Cytoplasmic | ||||
Sequence: WRRAGHSSYTPLPGSNYSEGWHIS |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 26 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: E → K | ||||||
Natural variant | VAR_050360 | 28 | in allele DMB*01:07; dbSNP:rs17583782 | |||
Sequence: T → A | ||||||
Natural variant | VAR_016752 | 45 | in allele DMB*01:06; dbSNP:rs41560814 | |||
Sequence: S → F | ||||||
Natural variant | VAR_050361 | 49 | in allele DMB*01:07; dbSNP:rs17617333 | |||
Sequence: D → V | ||||||
Mutagenesis | 49 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: D → K | ||||||
Mutagenesis | 49 | Increases the interaction with MHCII and peptide exchange; when associated with Q-65. | ||||
Sequence: D → N | ||||||
Mutagenesis | 65 | Increases the interaction with MHCII and peptide exchange; when associated with N-49. | ||||
Sequence: E → Q | ||||||
Mutagenesis | 65 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: E → R | ||||||
Mutagenesis | 69 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: L → D | ||||||
Natural variant | VAR_050362 | 71 | in allele DMB*01:07; dbSNP:rs17617321 | |||
Sequence: S → N | ||||||
Mutagenesis | 73 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: A → V | ||||||
Mutagenesis | 128 | Decreases the interaction with MHCII and peptide exchange. | ||||
Sequence: R → S | ||||||
Natural variant | VAR_016753 | 162 | in allele DMB*01:02 and allele DMB*01:06; dbSNP:rs2071555 | |||
Sequence: A → E | ||||||
Natural variant | VAR_016754 | 162 | in allele DMB*01:04 and allele DMB*01:05; dbSNP:rs2071555 | |||
Sequence: A → V | ||||||
Natural variant | VAR_016755 | 197 | in allele DMB*01:01; dbSNP:rs1042337 | |||
Sequence: T → I | ||||||
Mutagenesis | 248 | Abolishes targeting to endosomes and results in relocalization to the cell membrane. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 251 | Abolishes targeting to endosomes and results in relocalization to the cell membrane. | ||||
Sequence: L → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 429 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MITFLPLLLGLSLGCTGA | ||||||
Chain | PRO_0000018960 | 19-263 | HLA class II histocompatibility antigen, DM beta chain | |||
Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS | ||||||
Disulfide bond | 29↔97 | |||||
Sequence: CLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNC | ||||||
Disulfide bond | 43↔53 | |||||
Sequence: CISFNKDLLTC | ||||||
Glycosylation | 110 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 135↔192 | |||||
Sequence: CYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Heterodimer of an alpha chain (DMA) and a beta chain (DMB) (PubMed:16547258, PubMed:9768757).
Interacts with MHCII; this interaction mediates rapid selection of high-affinity peptides in a pH-dependent manner, with an optimum at pH 5.5 (PubMed:23260142).
Interacts with MHCII; this interaction mediates rapid selection of high-affinity peptides in a pH-dependent manner, with an optimum at pH 5.5 (PubMed:23260142).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P28068 | AP3M1 Q9Y2T2 | 2 | EBI-2877138, EBI-2371151 | |
BINARY | P28068 | HLA-DMA P28067 | 22 | EBI-2877138, EBI-3865396 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 19-112 | Beta-1 | ||||
Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRT | ||||||
Region | 113-207 | Beta-2 | ||||
Sequence: RPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDW | ||||||
Domain | 114-208 | Ig-like C1-type | ||||
Sequence: PPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWT | ||||||
Region | 208-218 | Connecting peptide | ||||
Sequence: TPGLSPMQTLK | ||||||
Motif | 248-251 | YXXZ motif | ||||
Sequence: YTPL |
Domain
The YXXZ (Tyr-Xaa-Xaa-Zaa, where Zaa is a hydrophobic residue) motif mediates the targeting to the lysosomal compartments.
Sequence similarities
Belongs to the MHC class II family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length263
- Mass (Da)28,931
- Last updated2022-02-23 v2
- Checksum9B50E72DD2A2454A
Computationally mapped potential isoform sequences
There are 25 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0Y7A2 | H0Y7A2_HUMAN | HLA-DMB | 141 | ||
H0Y4B8 | H0Y4B8_HUMAN | HLA-DMB | 106 | ||
A0A140T9T8 | A0A140T9T8_HUMAN | HLA-DMB | 175 | ||
A0A140T9U6 | A0A140T9U6_HUMAN | HLA-DMB | 175 | ||
A0A140T9K0 | A0A140T9K0_HUMAN | HLA-DMB | 106 | ||
A0A140T9K4 | A0A140T9K4_HUMAN | HLA-DMB | 106 | ||
A0A140T9K9 | A0A140T9K9_HUMAN | HLA-DMB | 106 | ||
A0A140T9Q5 | A0A140T9Q5_HUMAN | HLA-DMB | 141 | ||
A0A140T9Q8 | A0A140T9Q8_HUMAN | HLA-DMB | 106 | ||
A0A140T9R0 | A0A140T9R0_HUMAN | HLA-DMB | 175 | ||
A0A140T9R2 | A0A140T9R2_HUMAN | HLA-DMB | 175 | ||
A0A140T9C6 | A0A140T9C6_HUMAN | HLA-DMB | 141 | ||
A0A140T9C9 | A0A140T9C9_HUMAN | HLA-DMB | 175 | ||
A0A140T9E3 | A0A140T9E3_HUMAN | HLA-DMB | 141 | ||
A0A140T9F5 | A0A140T9F5_HUMAN | HLA-DMB | 141 | ||
A0A140T9F6 | A0A140T9F6_HUMAN | HLA-DMB | 106 | ||
A0A140T9I2 | A0A140T9I2_HUMAN | HLA-DMB | 175 | ||
A0A140T926 | A0A140T926_HUMAN | HLA-DMB | 175 | ||
A0A140T943 | A0A140T943_HUMAN | HLA-DMB | 106 | ||
A0A140T9B6 | A0A140T9B6_HUMAN | HLA-DMB | 141 | ||
A0A140T946 | A0A140T946_HUMAN | HLA-DMB | 106 | ||
A0A140T965 | A0A140T965_HUMAN | HLA-DMB | 141 | ||
A0A140T987 | A0A140T987_HUMAN | HLA-DMB | 141 | ||
A0A0G2JIJ2 | A0A0G2JIJ2_HUMAN | HLA-DMB | 257 | ||
A0A0G2JI43 | A0A0G2JI43_HUMAN | HLA-DMB | 257 |
Polymorphism
The following alleles of DMB are known: DMB*01:01, DMB*01:02, DMB*01:03, DMB*01:04 (DMB3.4), DMB*01:05, DMB*01:06, and DMB*01:07. The sequence shown is that of DMB*01:03.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z23139 EMBL· GenBank· DDBJ | CAA80670.1 EMBL· GenBank· DDBJ | mRNA | ||
U15085 EMBL· GenBank· DDBJ | AAB60387.1 EMBL· GenBank· DDBJ | mRNA | ||
X76776 EMBL· GenBank· DDBJ | CAA54171.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X87344 EMBL· GenBank· DDBJ | CAA60782.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY645722 EMBL· GenBank· DDBJ | AAV97947.1 EMBL· GenBank· DDBJ | mRNA | ||
AL662845 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL645941 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL935042 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BX088556 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BX927138 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CR936913 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CR759798 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CR752645 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471081 EMBL· GenBank· DDBJ | EAX03657.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC027175 EMBL· GenBank· DDBJ | AAH27175.1 EMBL· GenBank· DDBJ | mRNA | ||
Z24750 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z24751 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
U00700 EMBL· GenBank· DDBJ | AAA03296.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U16762 EMBL· GenBank· DDBJ | AAC50514.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF134890 EMBL· GenBank· DDBJ | AAD30279.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF072680 EMBL· GenBank· DDBJ | AAC26112.1 EMBL· GenBank· DDBJ | Genomic DNA |