P27869 · TMD11_CANLF
- ProteinTransmembrane emp24 domain-containing protein 11
- GeneTMED11
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids215 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Part of a complex whose function is to bind Ca2+ to the ER membrane and thereby regulate the retention of ER resident proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | COPII-coated ER to Golgi transport vesicle | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | Golgi apparatus | |
Molecular Function | cargo receptor activity | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | Golgi organization | |
Biological Process | intracellular protein transport |
Names & Taxonomy
Protein names
- Recommended nameTransmembrane emp24 domain-containing protein 11
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Caniformia > Canidae > Canis
Accessions
- Primary accessionP27869
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 18-167 | Lumenal | ||||
Sequence: FYFHVGEREEKCIIEDIPSDTLVTGTFKTQQWDFRRQDFLESAPGLGMFVTVTTYNDEVLLSKLYGPQGRFYFTSHSPGEHIICLESNSTRLVSFGGSKLRIHLEIRVGQHDLDAAIAQAKDKVNEVSFKLEHLIEQIEQIVKEQNYQRD | ||||||
Transmembrane | 168-185 | Helical | ||||
Sequence: REENFRMISEDTNSNVLW | ||||||
Topological domain | 186-215 | Cytoplasmic | ||||
Sequence: WAFAQTLIFIAIGIFQMKSLKNFFIAKKLV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-17 | |||||
Sequence: MPMLAFALSFYFSLSTA | ||||||
Chain | PRO_0000010378 | 18-215 | Transmembrane emp24 domain-containing protein 11 | |||
Sequence: FYFHVGEREEKCIIEDIPSDTLVTGTFKTQQWDFRRQDFLESAPGLGMFVTVTTYNDEVLLSKLYGPQGRFYFTSHSPGEHIICLESNSTRLVSFGGSKLRIHLEIRVGQHDLDAAIAQAKDKVNEVSFKLEHLIEQIEQIVKEQNYQRDREENFRMISEDTNSNVLWWAFAQTLIFIAIGIFQMKSLKNFFIAKKLV | ||||||
Glycosylation | 105 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 27-125 | GOLD | ||||
Sequence: EKCIIEDIPSDTLVTGTFKTQQWDFRRQDFLESAPGLGMFVTVTTYNDEVLLSKLYGPQGRFYFTSHSPGEHIICLESNSTRLVSFGGSKLRIHLEIRV | ||||||
Coiled coil | 129-171 | |||||
Sequence: DLDAAIAQAKDKVNEVSFKLEHLIEQIEQIVKEQNYQRDREEN | ||||||
Motif | 208-209 | COPII vesicle coat-binding | ||||
Sequence: FF | ||||||
Motif | 208-215 | COPI vesicle coat-binding | ||||
Sequence: FFIAKKLV |
Sequence similarities
Belongs to the EMP24/GP25L family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length215
- Mass (Da)24,882
- Last updated1992-08-01 v1
- Checksum4A0DA7DFD0075815
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I3RR51 | A0A8I3RR51_CANLF | TMED11 | 203 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X53592 EMBL· GenBank· DDBJ | CAA37662.1 EMBL· GenBank· DDBJ | mRNA |