P27782 · LEF1_MOUSE
- ProteinLymphoid enhancer-binding factor 1
- GeneLef1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids397 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that binds DNA in a sequence-specific manner (By similarity).
Participates in the Wnt signaling pathway (PubMed:11445543).
Activates transcription of target genes in the presence of CTNNB1 and EP300 (PubMed:12446687).
PIASG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (PubMed:11731474).
TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1 (By similarity).
Regulates T-cell receptor alpha enhancer function (By similarity).
Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression (PubMed:23562159).
Acts as a positive regulator of odontoblast differentiation during mesenchymal tooth germ formation, expression is repressed during the bell stage by MSX1-mediated inhibition of CTNNB1 signaling (PubMed:29148101).
May play a role in hair cell differentiation and follicle morphogenesis (PubMed:11445543).
Participates in the Wnt signaling pathway (PubMed:11445543).
Activates transcription of target genes in the presence of CTNNB1 and EP300 (PubMed:12446687).
PIASG antagonizes both Wnt-dependent and Wnt-independent activation by LEF1 (PubMed:11731474).
TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by LEF1 and CTNNB1 (By similarity).
Regulates T-cell receptor alpha enhancer function (By similarity).
Required for IL17A expressing gamma-delta T-cell maturation and development, via binding to regulator loci of BLK to modulate expression (PubMed:23562159).
Acts as a positive regulator of odontoblast differentiation during mesenchymal tooth germ formation, expression is repressed during the bell stage by MSX1-mediated inhibition of CTNNB1 signaling (PubMed:29148101).
May play a role in hair cell differentiation and follicle morphogenesis (PubMed:11445543).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 297-365 | HMG box | ||||
Sequence: IKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLymphoid enhancer-binding factor 1
- Short namesLEF-1
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP27782
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Found in nuclear bodies upon PIASG binding.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 19 | Strongly diminishes CTNNB1 binding and transactivation. Prevents nuclear translocation of CTNNB1. | ||||
Sequence: D → A | ||||||
Mutagenesis | 20 | Prevents nuclear translocation of CTNNB1. | ||||
Sequence: E → A | ||||||
Mutagenesis | 24 | Strongly diminishes CTNNB1 binding and transactivation. Prevents nuclear translocation of CTNNB1. | ||||
Sequence: F → A | ||||||
Mutagenesis | 26 | Prevents nuclear translocation of CTNNB1. | ||||
Sequence: D → A | ||||||
Mutagenesis | 27 | Prevents nuclear translocation of CTNNB1. | ||||
Sequence: E → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 31 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, cross-link, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000048596 | 1-397 | Lymphoid enhancer-binding factor 1 | |||
Sequence: MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI | ||||||
Cross-link | 25 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | ||||||
Modified residue | 130 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 153 | Phosphothreonine; by NLK | ||||
Sequence: T | ||||||
Modified residue | 164 | Phosphoserine; by NLK | ||||
Sequence: S | ||||||
Cross-link | 267 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K |
Post-translational modification
Phosphorylated at Thr-153 and/or Ser-164 by NLK (By similarity).
Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway (By similarity).
Phosphorylation by NLK at these sites represses LEF1-mediated transcriptional activation of target genes of the canonical Wnt signaling pathway (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in Vgamma1.1 and Vgamma2 gamma-delta T-cells, however not expressed in gamma-delta thymocytes fated for Il17a expression (at protein level) (PubMed:17218525, PubMed:23562159).
Expressed in alpha-beta T-cell lineages (PubMed:17218525).
Expressed in the thymus (PubMed:1827423).
Found in distinct epithelial cell compartments of the skin and is abundant in the hair-producing progenitors of the follicle (PubMed:10498690).
Expressed in alpha-beta T-cell lineages (PubMed:17218525).
Expressed in the thymus (PubMed:1827423).
Found in distinct epithelial cell compartments of the skin and is abundant in the hair-producing progenitors of the follicle (PubMed:10498690).
Developmental stage
Expressed in the lower molar mesenchyme at 13.5 dpc and 14.5 dpc (PubMed:8898217).
Expressed in the distal tooth bud epithelium and condensing tooth mesenchyme surrounding the tooth bud during the bud stage of mandibular molar tooth development at 13.5 dpc (PubMed:27713059).
Expressed in bell stage dental mesenchymal cells at 17.5 dpc (at protein level) (PubMed:29148101).
Detected throughout the basal layer, in ectodermal placodes and the underlying dermal condensates in embryonic skin, and in epithelium and mesenchyme from early hair germs at 16.5 dpc (at protein level) (PubMed:10498690).
At birth expression decreases in the basal level of the epidermis and increases in hair bulbs, in particular in matrix and precortex (PubMed:10498690).
At day 6-9 expression is concentrated in follicle bulbs and in the hair shaft in a concentric ring of hair-keratin-expressing cells derived from the precortex (PubMed:10498690).
Detected in dermal papilla throughout the hair cycle, and in a subset of cells emanating from the bulge to form the secondary hair germ (PubMed:10498690).
Expressed in the distal tooth bud epithelium and condensing tooth mesenchyme surrounding the tooth bud during the bud stage of mandibular molar tooth development at 13.5 dpc (PubMed:27713059).
Expressed in bell stage dental mesenchymal cells at 17.5 dpc (at protein level) (PubMed:29148101).
Detected throughout the basal layer, in ectodermal placodes and the underlying dermal condensates in embryonic skin, and in epithelium and mesenchyme from early hair germs at 16.5 dpc (at protein level) (PubMed:10498690).
At birth expression decreases in the basal level of the epidermis and increases in hair bulbs, in particular in matrix and precortex (PubMed:10498690).
At day 6-9 expression is concentrated in follicle bulbs and in the hair shaft in a concentric ring of hair-keratin-expressing cells derived from the precortex (PubMed:10498690).
Detected in dermal papilla throughout the hair cycle, and in a subset of cells emanating from the bulge to form the secondary hair germ (PubMed:10498690).
Gene expression databases
Interaction
Subunit
Binds the armadillo repeat of CTNNB1 and forms a stable complex. Binds TLE1, ALYREF/THOC4, MDFI and MDFIC (By similarity).
Interacts with NLK (By similarity).
Interacts with EP300 and PIASG. Interacts with DAZAP2 (PubMed:19304756).
Interacts with NLK (By similarity).
Interacts with EP300 and PIASG. Interacts with DAZAP2 (PubMed:19304756).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P27782 | Ctnnb1 Q02248 | 6 | EBI-984464, EBI-397872 | |
XENO | P27782 | CTNNB1 P35222 | 2 | EBI-984464, EBI-491549 | |
BINARY | P27782 | Hmgb2 P30681 | 2 | EBI-984464, EBI-6910056 | |
XENO | P27782 | JRK O75564 | 3 | EBI-984464, EBI-8607681 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-60 | CTNNB1-binding | ||||
Sequence: MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE | ||||||
Region | 59-102 | Disordered | ||||
Sequence: SEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNK | ||||||
Compositional bias | 79-97 | Basic and acidic residues | ||||
Sequence: EPYHDKAREHPDEGKHPDG | ||||||
Region | 164-191 | Disordered | ||||
Sequence: SPGSHPSHIPSDVNSKQGMSRHPPAPEI | ||||||
Region | 266-296 | Disordered | ||||
Sequence: VKQEHPHTDSDLMHVKPQHEQRKEQEPKRPH | ||||||
Compositional bias | 269-296 | Basic and acidic residues | ||||
Sequence: EHPHTDSDLMHVKPQHEQRKEQEPKRPH | ||||||
Region | 367-397 | Disordered | ||||
Sequence: RDNYGKKKKRKREKLQESTSGTGPRMTAAYI |
Domain
Proline-rich and acidic regions are implicated in the activation functions of RNA polymerase II transcription factors.
Sequence similarities
Belongs to the TCF/LEF family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P27782-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length397
- Mass (Da)44,059
- Last updated1992-08-01 v1
- Checksum0CA01B6C528FD7FA
P27782-2
- Name2
- SynonymsLEF-1S
- Differences from canonical
- 1-113: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006983 | 1-113 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 79-97 | Basic and acidic residues | ||||
Sequence: EPYHDKAREHPDEGKHPDG | ||||||
Compositional bias | 269-296 | Basic and acidic residues | ||||
Sequence: EHPHTDSDLMHVKPQHEQRKEQEPKRPH |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X58636 EMBL· GenBank· DDBJ | CAA41493.1 EMBL· GenBank· DDBJ | mRNA | ||
D16503 EMBL· GenBank· DDBJ | BAA03954.1 EMBL· GenBank· DDBJ | mRNA |