P27577 · ETS1_MOUSE
- ProteinProtein C-ets-1
- GeneEts1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids440 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor (PubMed:15994560).
Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts (By similarity).
May control the differentiation, survival and proliferation of lymphoid cells (By similarity).
May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion (By similarity).
Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts (By similarity).
May control the differentiation, survival and proliferation of lymphoid cells (By similarity).
May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion (By similarity).
Activity regulation
Autoinhibited by a module composed of four alpha helices (HI-1, HI-2, H4, and H5) that flank the DNA-binding ETS domain, reducing the affinity for DNA (PubMed:15591056, PubMed:15994560).
Phosphorylation by CaMK2/CaMKII in response to calcium signaling decreases affinity for DNA (PubMed:15994560).
Phosphorylation by CaMK2/CaMKII in response to calcium signaling decreases affinity for DNA (PubMed:15994560).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 335-415 | ETS | ||||
Sequence: IQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV |
GO annotations
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein C-ets-1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP27577
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 251 | Decreased phosphorylation, leading to decreased autoinhibition. Strongly decreased phosphorylation, leading to stongly decreased autoinhibition; when associated with 282-A--A-285. | ||||
Sequence: S → A | ||||||
Mutagenesis | 270 | Does not affect phosphorylation and autoinhibition. | ||||
Sequence: S → A | ||||||
Mutagenesis | 273 | Does not affect phosphorylation and autoinhibition. | ||||
Sequence: S → A | ||||||
Mutagenesis | 282-285 | Decreased phosphorylation, leading to decreased autoinhibition. Strongly decreased phosphorylation, leading to stongly decreased autoinhibition; when associated with A-251. | ||||
Sequence: SYDS → AYDA | ||||||
Mutagenesis | 429 | Reduced autoinhibition. | ||||
Sequence: L → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 17 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000204070 | 1-440 | Protein C-ets-1 | |||
Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD | ||||||
Modified residue | 8 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 8 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 15 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 15 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate | ||||
Sequence: K | ||||||
Cross-link | 15 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 38 | Phosphothreonine; by MAPK | ||||
Sequence: T | ||||||
Cross-link | 138 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 223 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Cross-link | 227 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | ||||||
Modified residue | 251 | Phosphoserine; by CaMK2 | ||||
Sequence: S | ||||||
Modified residue | 254 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 265 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 267 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 270 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 282 | Phosphoserine; by CaMK2 | ||||
Sequence: S | ||||||
Modified residue | 285 | Phosphoserine; by CaMK2 | ||||
Sequence: S | ||||||
Modified residue | 305 | N6-acetyllysine | ||||
Sequence: K |
Post-translational modification
Phosphorylation at Ser-251, Ser-282 and Ser-285 by CaMK2/CaMKII in response to calcium signaling decreases affinity for DNA: an increasing number of phosphoserines causes DNA-binding to become progressively weaker.
Sumoylated on Lys-15 and Lys-227, preferentially with SUMO2; which inhibits transcriptional activity.
Ubiquitinated; which induces proteasomal degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Binds DNA as a homodimer; homodimerization is required for transcription activation (PubMed:15591056).
Interacts with MAF and MAFB (PubMed:10790365, PubMed:9566892).
Interacts with PAX5; the interaction alters DNA-binding properties (PubMed:11779502).
Interacts with DAXX. Interacts with UBE2I. Interacts with SP100; the interaction is direct and modulates ETS1 transcriptional activity (By similarity).
Interacts with MAF and MAFB (PubMed:10790365, PubMed:9566892).
Interacts with PAX5; the interaction alters DNA-binding properties (PubMed:11779502).
Interacts with DAXX. Interacts with UBE2I. Interacts with SP100; the interaction is direct and modulates ETS1 transcriptional activity (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P27577 | Crebbp P45481 | 3 | EBI-4289053, EBI-296306 | |
XENO | P27577 | TLX1 P31314 | 2 | EBI-4289053, EBI-2820655 | |
XENO | P27577 | TLX3 O43711 | 2 | EBI-4289053, EBI-3939165 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 51-136 | PNT | ||||
Sequence: ATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKED | ||||||
Region | 130-243 | Activation domain; required for transcription activation | ||||
Sequence: EILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASR | ||||||
Region | 304-312 | Helix HI-1 | ||||
Sequence: FKDYVRDRA | ||||||
Region | 323-330 | Helix HI-2 | ||||
Sequence: AAALAGYT | ||||||
Region | 418-422 | Helix H4 | ||||
Sequence: LQSLL | ||||||
Region | 426-432 | Helix H5 | ||||
Sequence: PEELHAM |
Sequence similarities
Belongs to the ETS family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. At least 2 isoforms are produced.
P27577-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length440
- Mass (Da)50,202
- Last updated1995-02-01 v2
- Checksum151164D83C41B143
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
V9GXE2 | V9GXE2_MOUSE | Ets1 | 224 | ||
V9GX28 | V9GX28_MOUSE | Ets1 | 272 | ||
E9PWI8 | E9PWI8_MOUSE | Ets1 | 353 | ||
A0A5F8MPR7 | A0A5F8MPR7_MOUSE | Ets1 | 484 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 28 | in Ref. 1; AAA63299 and 3; CAA39310 | ||||
Sequence: D → E | ||||||
Sequence conflict | 37 | in Ref. 3; CAA39310 | ||||
Sequence: L → S | ||||||
Sequence conflict | 51-52 | in Ref. 3; CAA39310 | ||||
Sequence: AT → SY | ||||||
Sequence conflict | 55 | in Ref. 1; AAA63299 | ||||
Sequence: G → P | ||||||
Sequence conflict | 63 | in Ref. 3; CAA39310 | ||||
Sequence: L → R | ||||||
Sequence conflict | 74 | in Ref. 3; CAA39310 | ||||
Sequence: E → D | ||||||
Sequence conflict | 96 | in Ref. 3; CAA39310 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 105 | in Ref. 3; CAA39310 | ||||
Sequence: L → V | ||||||
Sequence conflict | 157 | in Ref. 3; CAA39310 | ||||
Sequence: D → V | ||||||
Sequence conflict | 211 | in Ref. 3; CAA39310 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 217 | in Ref. 3; CAA39310 | ||||
Sequence: D → E | ||||||
Sequence conflict | 225 | in Ref. 3; CAA39310 | ||||
Sequence: A → R | ||||||
Sequence conflict | 234 | in Ref. 3; CAA39310 | ||||
Sequence: D → N | ||||||
Sequence conflict | 360 | in Ref. 3; CAA39310 | ||||
Sequence: G → C | ||||||
Sequence conflict | 383 | in Ref. 3; CAA39310 | ||||
Sequence: K → S | ||||||
Sequence conflict | 392 | in Ref. 3; CAA39310 | ||||
Sequence: G → A | ||||||
Sequence conflict | 408-409 | in Ref. 3; CAA39310 | ||||
Sequence: KR → NA | ||||||
Sequence conflict | 413 | in Ref. 3; CAA39310 | ||||
Sequence: R → A |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M58482 EMBL· GenBank· DDBJ | AAA63299.1 EMBL· GenBank· DDBJ | mRNA | ||
X53953 EMBL· GenBank· DDBJ | CAA37904.1 EMBL· GenBank· DDBJ | mRNA | ||
X55787 EMBL· GenBank· DDBJ | CAA39310.1 EMBL· GenBank· DDBJ | mRNA | ||
BC010588 EMBL· GenBank· DDBJ | AAH10588.1 EMBL· GenBank· DDBJ | mRNA |