P27405 · CAPSD_FCVF4
- ProteinCapsid protein VP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids668 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Capsid protein self assembles to form an icosahedral capsid with a T=3 symmetry, about 38 nm in diameter, and consisting of 180 capsid proteins. A smaller form of capsid with a diameter of 23 nm might be capsid proteins assembled as icosahedron with T=1 symmetry. The capsid encapsulates the genomic RNA and is decorated with VP2 proteins. Attaches virion to target cells by binding to feline junctional adhesion molecule A (F11R) and/or to alpha-2,6-linked sialic acid. Once attached, the virion is endocytosed. Acidification of the endosome induces conformational change of capsid protein thereby injecting virus genomic RNA into host cytoplasm.
Capsid leader protein
May function as a viroporin.
Miscellaneous
Mostly expressed from a sgRNA. Expression from the g-RNA is low and occurs at a downstream start codon generating a smaller, truncated LC-VP1 (tLC-VP1) protein.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 124-125 | Cleavage; by viral protease | ||||
Sequence: EA | ||||||
Site | 124-125 | Cleavage; by viral proteases | ||||
Sequence: EA | ||||||
Site | 459 | Interaction with host receptor F11R/JAM-1 | ||||
Sequence: N | ||||||
Site | 462 | Interaction with host receptor F11R/JAM-1 | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | T=3 icosahedral viral capsid |
Names & Taxonomy
Protein names
- Recommended nameCapsid protein VP1
- Short namesCP
- Alternative names
- Cleaved into 3 chains
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Picornavirales > Caliciviridae > Vesivirus > Feline calicivirus
- Virus hosts
Accessions
- Primary accessionP27405
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Mature capsid protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000460231 | 1-124 | Capsid leader protein | |||
Sequence: MCSTCANVLKYYDWDPHFRLIINPNKFLPIGFCDNPLMCCYPDLLPEFGTVWDCDQSPLQIYLESILGDDEWASTHEAIDPSVPPMHWDSAGKIFQPHPGVLMHHLIGEVAKAWDPNLPLFRLE | ||||||
Chain | PRO_0000460230 | 1-668 | Capsid protein VP1 | |||
Sequence: MCSTCANVLKYYDWDPHFRLIINPNKFLPIGFCDNPLMCCYPDLLPEFGTVWDCDQSPLQIYLESILGDDEWASTHEAIDPSVPPMHWDSAGKIFQPHPGVLMHHLIGEVAKAWDPNLPLFRLEADDGSITTPEQGTAVGGVIAEPSAQMSTAADMASGKSVDSEWEAFFSFHTSVNWSTSETQGKILFKQSLGPLLNPYLEHLSKLYVAWSGSIEVRFSISGSGVFGGKLAAIVVPPGVDPVQSTSMLQYPHVLFDARQVEPVIFTIPDLRSTLYHVMSDTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGPDFKFHLLKPPGSVLTHGSIPSDLIPKSSSLWIGNRYWTDITDFVIRPFVFQANRHFDFNQETAGWSTPRFRPITITISEKNGSKLGIGVATDYIIPGIPDGWPDTTIADKLIPAGDYSITTGEGNDIKTAQAYDTAAVVKNTTNFRGMYICGSLQRAWGDKKISNTAFITTAIRDGNEIKPSNTIDMTKLAVYQDTHVEQEVQTSDDTLALLGYTGIGEEAIGSNRDRVVRISVLPEAGARGGNHPIFYKNSIKLGYVIRSIDVFNSQILHTSRQLSLNHYLLPPDSFAVYRIIDSNGSWFDIGIDSEGFSFVGVSDIGKLEFPLSASYMGIQLAKIRLASNIRSRMTKL | ||||||
Chain | PRO_0000036877 | 125-668 | Mature capsid protein | |||
Sequence: ADDGSITTPEQGTAVGGVIAEPSAQMSTAADMASGKSVDSEWEAFFSFHTSVNWSTSETQGKILFKQSLGPLLNPYLEHLSKLYVAWSGSIEVRFSISGSGVFGGKLAAIVVPPGVDPVQSTSMLQYPHVLFDARQVEPVIFTIPDLRSTLYHVMSDTDTTSLVIMVYNDLINPYANDSNSSGCIVTVETKPGPDFKFHLLKPPGSVLTHGSIPSDLIPKSSSLWIGNRYWTDITDFVIRPFVFQANRHFDFNQETAGWSTPRFRPITITISEKNGSKLGIGVATDYIIPGIPDGWPDTTIADKLIPAGDYSITTGEGNDIKTAQAYDTAAVVKNTTNFRGMYICGSLQRAWGDKKISNTAFITTAIRDGNEIKPSNTIDMTKLAVYQDTHVEQEVQTSDDTLALLGYTGIGEEAIGSNRDRVVRISVLPEAGARGGNHPIFYKNSIKLGYVIRSIDVFNSQILHTSRQLSLNHYLLPPDSFAVYRIIDSNGSWFDIGIDSEGFSFVGVSDIGKLEFPLSASYMGIQLAKIRLASNIRSRMTKL | ||||||
Chain | PRO_0000341980 | ?465-668 | Protein 40k | |||
Sequence: GMYICGSLQRAWGDKKISNTAFITTAIRDGNEIKPSNTIDMTKLAVYQDTHVEQEVQTSDDTLALLGYTGIGEEAIGSNRDRVVRISVLPEAGARGGNHPIFYKNSIKLGYVIRSIDVFNSQILHTSRQLSLNHYLLPPDSFAVYRIIDSNGSWFDIGIDSEGFSFVGVSDIGKLEFPLSASYMGIQLAKIRLASNIRSRMTKL |
Post-translational modification
Capsid protein VP1
Cleaved by the viral protease to produce mature capsid protein (By similarity).
Cleaved by host caspase-2 and caspase-6 to generate protein p40, this might be linked to the cytopathic effect of the capsid leader protein (By similarity).
Cleaved by host caspase-2 and caspase-6 to generate protein p40, this might be linked to the cytopathic effect of the capsid leader protein (By similarity).
Keywords
- PTM
Interaction
Subunit
Homodimer (By similarity).
Homomultimer (By similarity).
Interacts with the minor capsid protein VP2 (By similarity).
May bind to VP3 and Vpg proteins. Binds to alpha-2,6-linked sialic acid at surface of target cells (By similarity).
Interacts with host F11R/JAM-1/JAM-A; this interaction allows viral binding and entry into the host cell (PubMed:16611908).
Homomultimer (By similarity).
Interacts with the minor capsid protein VP2 (By similarity).
May bind to VP3 and Vpg proteins. Binds to alpha-2,6-linked sialic acid at surface of target cells (By similarity).
Interacts with host F11R/JAM-1/JAM-A; this interaction allows viral binding and entry into the host cell (PubMed:16611908).
Capsid leader protein
Homooligomer; probably disulfide-linked.
Sequence
- Sequence statusComplete
- Length668
- Mass (Da)73,589
- Last updated1992-08-01 v1
- Checksum85BBDCB85804E503