P26992 · CNTFR_HUMAN
- ProteinCiliary neurotrophic factor receptor subunit alpha
- GeneCNTFR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids372 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds to CNTF. The alpha subunit provides the receptor specificity. Receptor for heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1 (PubMed:26858303).
Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and IL27RA/WSX1 (PubMed:19386761).
Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and IL27RA/WSX1 (PubMed:19386761).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCiliary neurotrophic factor receptor subunit alpha
- Short namesCNTF receptor subunit alpha; CNTFR-alpha
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP26992
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 440 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MAAPVPWACCAVLAAAAAVVYA | ||||||
Chain | PRO_0000010991 | 23-342 | Ciliary neurotrophic factor receptor subunit alpha | |||
Sequence: QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGS | ||||||
Disulfide bond | 46↔89 | |||||
Sequence: CGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYAC | ||||||
Glycosylation | 60 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 70 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 142 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 190 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 342 | GPI-anchor amidated serine | ||||
Sequence: S | ||||||
Propeptide | PRO_0000010992 | 343-372 | Removed in mature form | |||
Sequence: GGGPSAPFLVSVPITLALAAAAATASSLLI |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Nervous system and skeletal muscle.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms a heterotrimer with LIFR and IL6ST. Interacts with heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1 (PubMed:26858303).
Either alone or in complex with the heterodimer CLCF1-CRLF1 interacts with SORL1; this interaction may promote internalization and lysosomal degradation (PubMed:26858303).
Component of a receptor complex composed of IL6ST/GP130, IL27RA/WSX1 and CNTFR which interacts with the neuroprotective peptide humanin (PubMed:19386761).
Either alone or in complex with the heterodimer CLCF1-CRLF1 interacts with SORL1; this interaction may promote internalization and lysosomal degradation (PubMed:26858303).
Component of a receptor complex composed of IL6ST/GP130, IL27RA/WSX1 and CNTFR which interacts with the neuroprotective peptide humanin (PubMed:19386761).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P26992 | CLCF1 PRO_0000015616 Q9UBD9 | 3 | EBI-743758, EBI-25298664 | |
BINARY | P26992 | CNTF P26441 | 13 | EBI-743758, EBI-1050897 | |
BINARY | P26992 | SORL1 Q92673 | 7 | EBI-743758, EBI-1171329 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 27-104 | Ig-like C2-type | ||||
Sequence: PQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLH | ||||||
Domain | 108-205 | Fibronectin type-III 1 | ||||
Sequence: PPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPD | ||||||
Domain | 206-306 | Fibronectin type-III 2 | ||||
Sequence: PPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEP | ||||||
Motif | 290-294 | WSXWS motif | ||||
Sequence: WSDWS | ||||||
Region | 301-340 | Disordered | ||||
Sequence: PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGEL | ||||||
Compositional bias | 312-330 | Polar residues | ||||
Sequence: EAQAAETTTSTTSSLAPPP |
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
Sequence similarities
Belongs to the type I cytokine receptor family. Type 3 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length372
- Mass (Da)40,633
- Last updated1996-02-01 v2
- ChecksumB2F3F73DE8F8750E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5T8H6 | Q5T8H6_HUMAN | CNTFR | 256 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 312-330 | Polar residues | ||||
Sequence: EAQAAETTTSTTSSLAPPP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M73238 EMBL· GenBank· DDBJ | AAA35707.1 EMBL· GenBank· DDBJ | mRNA | ||
L38025 EMBL· GenBank· DDBJ | AAA91337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L38022 EMBL· GenBank· DDBJ | AAA91337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L38023 EMBL· GenBank· DDBJ | AAA91337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L38024 EMBL· GenBank· DDBJ | AAA91337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT019824 EMBL· GenBank· DDBJ | AAV38627.1 EMBL· GenBank· DDBJ | mRNA | ||
AL160270 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471071 EMBL· GenBank· DDBJ | EAW58445.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471071 EMBL· GenBank· DDBJ | EAW58446.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471071 EMBL· GenBank· DDBJ | EAW58447.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471071 EMBL· GenBank· DDBJ | EAW58448.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001492 EMBL· GenBank· DDBJ | AAH01492.1 EMBL· GenBank· DDBJ | mRNA |