P26955 · IL3RB_MOUSE
- ProteinCytokine receptor common subunit beta
- GeneCsf2rb
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids896 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
High affinity receptor for interleukin-3, interleukin-5 and granulocyte-macrophage colony-stimulating factor.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Molecular Function | cytokine receptor activity | |
Biological Process | cytokine-mediated signaling pathway | |
Biological Process | immunoglobulin mediated immune response | |
Biological Process | regulation of cell growth |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytokine receptor common subunit beta
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP26955
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-441 | Extracellular | ||||
Sequence: HGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDW | ||||||
Transmembrane | 442-463 | Helical | ||||
Sequence: VMPTLWIVLILVFLILTLLLIL | ||||||
Topological domain | 464-896 | Cytoplasmic | ||||
Sequence: RFGCVSVYRTYRKWKEKIPNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGESYAHLEDNNVSPLTIEDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQSHSLPDLPDQLGSPQVGGSLKPALPGSLEYMCLPPGGQAQLVPLSQVMGQGQAMDVQCGSSLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTLPTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAAKSPPGHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPSPSLCSETEDLVQDLSVKKFPYQPMPQAPAIQFFKSLKHQDYLSLPPWDNSQSGKVC |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MDQQMALTWGLCYMALVALCWG | ||||||
Chain | PRO_0000010863 | 23-896 | Cytokine receptor common subunit beta | |||
Sequence: HGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDWVMPTLWIVLILVFLILTLLLILRFGCVSVYRTYRKWKEKIPNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGESYAHLEDNNVSPLTIEDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQSHSLPDLPDQLGSPQVGGSLKPALPGSLEYMCLPPGGQAQLVPLSQVMGQGQAMDVQCGSSLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTLPTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAAKSPPGHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPSPSLCSETEDLVQDLSVKKFPYQPMPQAPAIQFFKSLKHQDYLSLPPWDNSQSGKVC | ||||||
Disulfide bond | 39↔49 | |||||
Sequence: CYNDYTNHIIC | ||||||
Glycosylation | 62 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 77↔99 | |||||
Sequence: CELSEELMWSECPSSHRCVPRRC | ||||||
Disulfide bond | 88↔94 | |||||
Sequence: CPSSHRC | ||||||
Glycosylation | 141 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 253↔263 | |||||
Sequence: CFFDGIQSLHC | ||||||
Disulfide bond | 292↔310 | |||||
Sequence: CSPVVKEPPGASVYTRYHC | ||||||
Glycosylation | 350 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 752 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 754 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 765 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
May be phosphorylated by LYN.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Heterodimer of an alpha and a beta subunit (PubMed:10477686).
The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. Interacts with TMEM102; this interaction occurs preferentially in the absence of CSF2 (By similarity).
Interacts with FCER1G; this interaction is direct (PubMed:19098920).
Interacts with LYN
The beta subunit is common to the IL3, IL5 and GM-CSF receptors. The signaling GM-CSF receptor complex is a dodecamer of two head-to-head hexamers of two alpha, two beta, and two ligand subunits. Interacts with TMEM102; this interaction occurs preferentially in the absence of CSF2 (By similarity).
Interacts with FCER1G; this interaction is direct (PubMed:19098920).
Interacts with LYN
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P26955 | Itgb1 P09055 | 2 | EBI-1810026, EBI-644224 | |
BINARY | P26955 | Kit P05532 | 4 | EBI-1810026, EBI-8559255 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 136-243 | Fibronectin type-III 1 | ||||
Sequence: PPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPG | ||||||
Region | 220-243 | Disordered | ||||
Sequence: SPGSSLSGRPSRWSPEVHWDSQPG | ||||||
Domain | 343-439 | Fibronectin type-III 2 | ||||
Sequence: QMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKT | ||||||
Motif | 428-432 | WSXWS motif | ||||
Sequence: WSKWS | ||||||
Motif | 477-485 | Box 1 motif | ||||
Sequence: WKEKIPNPS | ||||||
Region | 543-620 | Disordered | ||||
Sequence: EDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQSHSLPDLPDQLGSPQVGGSL | ||||||
Compositional bias | 556-575 | Polar residues | ||||
Sequence: DTTPAASSESTEQLPNVQVE | ||||||
Region | 658-725 | Disordered | ||||
Sequence: CGSSLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTLPTGPL | ||||||
Region | 771-810 | Disordered | ||||
Sequence: SVSQAAKSPPGHPAPPVASSPTVIPGEPREEVGPASPHPE |
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length896
- Mass (Da)99,036
- Last updated2011-07-27 v2
- Checksum8E30ECB42C67F89A
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8VHF2 | A0A2R8VHF2_MOUSE | Csf2rb | 46 | ||
A0A2R8VK01 | A0A2R8VK01_MOUSE | Csf2rb | 541 | ||
A0A338P6R9 | A0A338P6R9_MOUSE | Csf2rb | 66 |
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 82 | in Ref. 1; AAA37204 | ||||
Sequence: E → K | ||||||
Sequence conflict | 213 | in Ref. 1; AAA37204 | ||||
Sequence: A → P | ||||||
Sequence conflict | 220 | in Ref. 1; AAA37204 | ||||
Sequence: S → Y | ||||||
Sequence conflict | 236 | in Ref. 1; AAA37204 | ||||
Sequence: V → A | ||||||
Compositional bias | 556-575 | Polar residues | ||||
Sequence: DTTPAASSESTEQLPNVQVE | ||||||
Sequence conflict | 634 | in Ref. 1; AAA37204 | ||||
Sequence: P → A | ||||||
Sequence conflict | 639 | in Ref. 1; AAA37204 | ||||
Sequence: A → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M34397 EMBL· GenBank· DDBJ | AAA37204.1 EMBL· GenBank· DDBJ | mRNA | ||
AK152608 EMBL· GenBank· DDBJ | BAE31354.1 EMBL· GenBank· DDBJ | mRNA |