P26308 · GBB1_DROME
- ProteinGuanine nucleotide-binding protein subunit beta-1
- GeneGbeta13F
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids340 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | heterotrimeric G-protein complex | |
Cellular Component | plasma membrane | |
Molecular Function | signaling receptor complex adaptor activity | |
Biological Process | apical protein localization | |
Biological Process | asymmetric neuroblast division | |
Biological Process | cell adhesion involved in heart morphogenesis | |
Biological Process | convergent extension involved in gastrulation | |
Biological Process | establishment or maintenance of cytoskeleton polarity involved in gastrulation | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | mesectoderm development | |
Biological Process | negative regulation of smoothened signaling pathway | |
Biological Process | regulation of gastrulation | |
Biological Process | regulation of myosin II filament organization |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGuanine nucleotide-binding protein subunit beta-1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP26308
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127715 | 1-340 | Guanine nucleotide-binding protein subunit beta-1 | |||
Sequence: MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRFLDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRVWN | ||||||
Modified residue | 29 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the brain neuropil and cortex, and the thoracic ganglion (at protein level) (PubMed:1910788).
Expression detected in eye at protein level but not at mRNA level, suggesting cross reactivity of antibodies to the similar Gbeta76C protein (PubMed:1910788).
Expression detected in eye at protein level but not at mRNA level, suggesting cross reactivity of antibodies to the similar Gbeta76C protein (PubMed:1910788).
Developmental stage
Expressed throughout development (PubMed:3140235).
In adults, expression is higher in the head than in the body (PubMed:3140235).
Expressed in pupal brain and thoracic ganglion, but not in the eye (PubMed:1910788).
In adults, expression is higher in the head than in the body (PubMed:3140235).
Expressed in pupal brain and thoracic ganglion, but not in the eye (PubMed:1910788).
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 53-92 | WD 1 | ||||
Sequence: GHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHA | ||||||
Repeat | 95-134 | WD 2 | ||||
Sequence: LRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVR | ||||||
Repeat | 141-179 | WD 3 | ||||
Sequence: GHGGYLSCCRFLDDNQIVTSSGDMSCGLWDIETGLQVTS | ||||||
Repeat | 182-221 | WD 4 | ||||
Sequence: GHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQT | ||||||
Repeat | 224-263 | WD 5 | ||||
Sequence: GHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAM | ||||||
Repeat | 268-307 | WD 6 | ||||
Sequence: NIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGI | ||||||
Repeat | 310-340 | WD 7 | ||||
Sequence: GHDNRVSCLGVTENGMAVATGSWDSFLRVWN |
Sequence similarities
Belongs to the WD repeat G protein beta family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length340
- Mass (Da)37,133
- Last updated1992-05-01 v1
- Checksum5A4B70DCB0A1C32C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A4V4I0 | A4V4I0_DROME | Gbeta13F | 340 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M22567 EMBL· GenBank· DDBJ | AAB59247.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF48530.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY058566 EMBL· GenBank· DDBJ | AAL13795.1 EMBL· GenBank· DDBJ | mRNA |