P25974 · GLCB1_SOYBN
- ProteinBeta-conglycinin beta subunit 1
- GeneCG-4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids439 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Seed storage protein. Accumulates during seed development and is hydrolyzed after germination to provide a carbon and nitrogen source for the developing seedling.
Miscellaneous
Mutagenesis of Ile-145 and Lys-147 allow the creation of a beta-conglycinin beta chain containing a phagocytosis-stimulating peptide, soymetide, found normally only in the alpha' chain. The three mutants created exhibit phagocytosis activities after digestion by trypsin and the order is wild type < I145M/K147T < I145M/K147F < I145M/K147W.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | aleurone grain | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | protein storage vacuole | |
Molecular Function | nutrient reservoir activity |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBeta-conglycinin beta subunit 1
- Short namesCG-beta-1
- Alternative names
- Allergen nameGly m 5
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Glycine > Glycine subgen. Soja
Accessions
- Primary accessionP25974
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human (PubMed:18996574).
Binds to IgE of patients with severe allergic reactions (anaphylaxis) to soybean (PubMed:18996574).
Binds to IgE of patients with severe allergic reactions (anaphylaxis) to soybean (PubMed:18996574).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 145 | Little or no effect on the secondary structure and strong phagocytosis-stimulating activity; when associated with T-147; F-147 or W-147. | ||||
Sequence: I → M | ||||||
Mutagenesis | 147 | Little or no effect on the secondary structure and strong phagocytosis-stimulating activity; when associated with M-145. | ||||
Sequence: K → T, F, or W |
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MMRVRFPLLVLLGTVFLASVCVS | ||||||
Chain | PRO_0000032191 | 24-439 | Beta-conglycinin beta subunit 1 | |||
Sequence: LKVREDENNPFYLRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEINRVLFGEEEEQRQQEGVIVELSKEQIRQLSRRAKSSSRKTISSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPSILGALY | ||||||
Glycosylation | 351 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
The N-linked glycans are not essential for the folding and assembly into trimers.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in seeds. Not detected in cotyledons or in mature plants.
Developmental stage
Expressed early in embryogenesis, with a high transcription rate at midmaturation and then decreases prior to seed dormancy.
Interaction
Subunit
The alpha-, alpha'-, and beta-subunits associate in various combinations to form trimeric proteins.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 34-193 | Cupin type-1 1 | ||||
Sequence: FYLRSSNSFQTLFENQNGRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPHHADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPHDHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSEFEEIN | ||||||
Domain | 240-401 | Cupin type-1 2 | ||||
Sequence: FNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGALLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAELSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQIERQVQELAFPGSAQDVE | ||||||
Region | 411-439 | Disordered | ||||
Sequence: YFVDAQPQQKEEGSKGRKGPFPSILGALY | ||||||
Region | 430-439 | Necessary for sorting to protein storage vacuole | ||||
Sequence: PFPSILGALY |
Sequence similarities
Belongs to the 7S seed storage protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length439
- Mass (Da)50,476
- Last updated2019-01-16 v2
- Checksum86D20314FC21D9E7
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 36 | in Ref. 1; AAB23463 | ||||
Sequence: L → F | ||||||
Sequence conflict | 39 | in Ref. 4; AA sequence | ||||
Sequence: S → V | ||||||
Sequence conflict | 44 | in Ref. 4; AA sequence | ||||
Sequence: T → G | ||||||
Sequence conflict | 50 | in Ref. 4; AA sequence | ||||
Sequence: N → D | ||||||
Sequence conflict | 51 | in Ref. 1; AAB23463 | ||||
Sequence: G → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S44893 EMBL· GenBank· DDBJ | AAB23463.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000853 EMBL· GenBank· DDBJ | KRG91303.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
ACUP02012674 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |