P24896 · NU5M_CAEEL
- ProteinNADH-ubiquinone oxidoreductase chain 5
- Genenduo-5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids527 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Catalytic activity
- a ubiquinone + NADH + 5 H+(in) = a ubiquinol + NAD+ + 4 H+(out)
a ubiquinone RHEA-COMP:9565 + CHEBI:57945 + 5 H+ (in)CHEBI:15378= a ubiquinol RHEA-COMP:9566 + CHEBI:57540 + 4 H+ (out)CHEBI:15378
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respiratory chain complex I | |
Molecular Function | NADH dehydrogenase (ubiquinone) activity | |
Molecular Function | NADH dehydrogenase activity | |
Biological Process | electron transport coupled proton transport | |
Biological Process | mitochondrial electron transport, NADH to ubiquinone |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNADH-ubiquinone oxidoreductase chain 5
- EC number
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP24896
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 3-23 | Helical | ||||
Sequence: ISIFLIGFVFFMGGISVWLMP | ||||||
Transmembrane | 43-63 | Helical | ||||
Sequence: FYFNSILFSFILFLVTFSVLV | ||||||
Transmembrane | 75-95 | Helical | ||||
Sequence: FNYYYFVLLIFVGSMFSLNFS | ||||||
Transmembrane | 98-118 | Helical | ||||
Sequence: IFTMLLSWDLLGISSFFLVLF | ||||||
Transmembrane | 141-161 | Helical | ||||
Sequence: FMFVFFGLSVFSGYYFLSFSM | ||||||
Transmembrane | 168-188 | Helical | ||||
Sequence: LLLLLTAFTKSAQFPFSSWLP | ||||||
Transmembrane | 197-217 | Helical | ||||
Sequence: VSSLVHSSTLVTAGLILLMNF | ||||||
Transmembrane | 226-246 | Helical | ||||
Sequence: FISFVLIIGLFTMFFSSLASL | ||||||
Transmembrane | 263-283 | Helical | ||||
Sequence: MGFSMVTLGLGLSFISFIHLV | ||||||
Transmembrane | 318-338 | Helical | ||||
Sequence: LPNFIQLQMLVTLFCLCGLIF | ||||||
Transmembrane | 357-377 | Helical | ||||
Sequence: YMMFFSLMFFVSVFLTFGYSF | ||||||
Transmembrane | 398-418 | Helical | ||||
Sequence: VFMNFLSLVLVIFSISFLWWM | ||||||
Transmembrane | 432-452 | Helical | ||||
Sequence: VDFFGPLVFLFMMIFLSFLIL | ||||||
Transmembrane | 507-527 | Helical | ||||
Sequence: YLKSLNFNSVVVLIFIFFMIC |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 94 | in strain: CB4854 | ||||
Sequence: F → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000118072 | 1-527 | NADH-ubiquinone oxidoreductase chain 5 | |||
Sequence: MNISIFLIGFVFFMGGISVWLMPTFKLGIFFLEWDFLSLKFNFYFNSILFSFILFLVTFSVLVFSTYYLNSELNFNYYYFVLLIFVGSMFSLNFSNSIFTMLLSWDLLGISSFFLVLFYNNWDSCSGAMNTALTNRLGDYFMFVFFGLSVFSGYYFLSFSMFSSYMSLLLLLTAFTKSAQFPFSSWLPKAMSAPTPVSSLVHSSTLVTAGLILLMNFNNLVMQKDFISFVLIIGLFTMFFSSLASLVEEDLKKVVALSTLSQMGFSMVTLGLGLSFISFIHLVSHALFKSCLFMQVGYIIHCSFGQQDGRNYSNNGNLPNFIQLQMLVTLFCLCGLIFSSGAVSKDFILELFFSNNYMMFFSLMFFVSVFLTFGYSFRLWKSFFLSFNKVMNHYSSTVFMNFLSLVLVIFSISFLWWMNFNLLNIPSLFLYVDFFGPLVFLFMMIFLSFLILKMLFKELMYKFLVDYLAKNSIYKMKNLKFMDLFLNNINSKGYTLFLSSGMFKNYYLKSLNFNSVVVLIFIFFMIC |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length527
- Mass (Da)61,156
- Last updated1995-11-01 v2
- Checksum8B804E4E0FF1EF72
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54252 EMBL· GenBank· DDBJ | CAA38162.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171208 EMBL· GenBank· DDBJ | AAO16356.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171209 EMBL· GenBank· DDBJ | AAO16358.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171210 EMBL· GenBank· DDBJ | AAO16360.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171211 EMBL· GenBank· DDBJ | AAO16362.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171212 EMBL· GenBank· DDBJ | AAO16364.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171213 EMBL· GenBank· DDBJ | AAO16366.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171214 EMBL· GenBank· DDBJ | AAO16368.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171215 EMBL· GenBank· DDBJ | AAO16370.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171216 EMBL· GenBank· DDBJ | AAO16372.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171217 EMBL· GenBank· DDBJ | AAO16374.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171218 EMBL· GenBank· DDBJ | AAO16376.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171219 EMBL· GenBank· DDBJ | AAO16378.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171220 EMBL· GenBank· DDBJ | AAO16380.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171221 EMBL· GenBank· DDBJ | AAO16382.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY171222 EMBL· GenBank· DDBJ | AAO16384.1 EMBL· GenBank· DDBJ | Genomic DNA |