P24374 · GVPJ1_HALSA
- ProteinGas vesicle protein J1
- GenegvpJ11; gvpJ1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids114 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Proteins GvpF to GvpM might be involved in nucleating gas vesicle formation (Probable) (PubMed:15126480, PubMed:24846741, PubMed:33281806, PubMed:34975818).
Mutagenesis of residues 13-61 shows that almost none of them can be substituted and still make gas vesicles (PubMed:34975818).
A minor component of the gas vesicle (Probable) (PubMed:15126480, PubMed:21158390).
Gas vesicles are hollow, gas filled proteinaceous nanostructures found in several microbial planktonic microorganisms. They allow positioning of halobacteria at the optimal depth for growth in the poorly aerated, shallow brine pools of their habitat (PubMed:33711860).
Mutagenesis of residues 13-61 shows that almost none of them can be substituted and still make gas vesicles (PubMed:34975818).
A minor component of the gas vesicle (Probable) (PubMed:15126480, PubMed:21158390).
Gas vesicles are hollow, gas filled proteinaceous nanostructures found in several microbial planktonic microorganisms. They allow positioning of halobacteria at the optimal depth for growth in the poorly aerated, shallow brine pools of their habitat (PubMed:33711860).
Expression of a 9.5 kb p-vac DNA fragment containing 2 divergently transcribed regions (gvpD-gvpE-gvpF-gvpG-gvpH-gvpI-gvpJ-gvpK-gvpL-gvpM and gvpA-gvpC-gvpN-gvpO) allows H.volcanii to produce gas vesicles. All site-directed mutagenesis is tested in H.volcanii (PubMed:10894744, PubMed:1404376, PubMed:7651141).
A minimal gas vesicle can be made in H.volcanii by gvpA1-gvpO1 plus gvpF1-gvpG1-gvpJ1-gvpK1-gvpL1-gvpM1; lack of enough GvpJ1 prevents formation (PubMed:10894744).
A similar region restores gas vesicle production in H.halobium without the p-vac locus, but it still has the c-vac locus (PubMed:1398080, PubMed:8002589).
A minimal gas vesicle can be made in H.volcanii by gvpA1-gvpO1 plus gvpF1-gvpG1-gvpJ1-gvpK1-gvpL1-gvpM1; lack of enough GvpJ1 prevents formation (PubMed:10894744).
A similar region restores gas vesicle production in H.halobium without the p-vac locus, but it still has the c-vac locus (PubMed:1398080, PubMed:8002589).
Miscellaneous
Encoded in a 14-gene plasmid locus called p-vac which produces predominantly short, spindle-shaped gas vesicles during all stages of growth.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | gas vesicle | |
Cellular Component | vesicle membrane | |
Molecular Function | structural molecule activity |
Names & Taxonomy
Protein names
- Recommended nameGas vesicle protein J1
- Short namesGvpJ1
Gene names
Encoded on
- Plasmid pNRC100
- Plasmid pNRC200
- Plasmid pHH1
Organism names
- Strains
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Halobacteria > Halobacteriales > Halobacteriaceae > Halobacterium > Halobacterium salinarum NRC-34001
Accessions
- Primary accessionP24374
- Secondary accessions
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Deletion of this gene prevents gas vesicle formation.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2-4 | Makes a few gas vesicles, still interacts with GvpL. | ||||
Sequence: Missing | ||||||
Mutagenesis | 2-5 | Does not make gas vesicles, still interacts with GvpL. | ||||
Sequence: Missing | ||||||
Mutagenesis | 13 | Does not make gas vesicles, still interacts with GvpL. | ||||
Sequence: L → A | ||||||
Mutagenesis | 13 | Very few gas vesicles, still interacts with GvpL. | ||||
Sequence: L → I | ||||||
Mutagenesis | 19 | Makes no gas vesicles, decreased interaction with GvpL. | ||||
Sequence: M → E | ||||||
Mutagenesis | 20 | Makes no gas vesicles, decreased interaction with GvpL. | ||||
Sequence: L → A | ||||||
Mutagenesis | 22 | Mix of cylindrical and spindle-shaped gas vesicles, still interacts with GvpL. | ||||
Sequence: D → A | ||||||
Mutagenesis | 23 | Unstable gas vesicles that do not float, still interacts with GvpL. | ||||
Sequence: K → A | ||||||
Mutagenesis | 24 | Makes no gas vesicles, decreased interaction with GvpL. | ||||
Sequence: G → A or S | ||||||
Mutagenesis | 25 | Unstable gas vesicles that do not float, still interacts with GvpL. | ||||
Sequence: V → A | ||||||
Mutagenesis | 39 | Very few gas vesicles, still interacts with GvpL. | ||||
Sequence: E → A | ||||||
Mutagenesis | 46 | Unstable gas vesicles that do not float, still interacts with GvpL. | ||||
Sequence: R → A | ||||||
Mutagenesis | 58 | Makes no gas vesicles, decreased interaction with GvpL. | ||||
Sequence: Y → E | ||||||
Mutagenesis | 69 | Cylindrical gas vesicles, still interacts with GvpL. | ||||
Sequence: E → A | ||||||
Mutagenesis | 74 | Does not make gas vesicles, still interacts with GvpL. | ||||
Sequence: A → D | ||||||
Mutagenesis | 110-114 | Does not make gas vesicles, still interacts with GvpL. | ||||
Sequence: Missing |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000200003 | 1-114 | Gas vesicle protein J1 | |||
Sequence: MSDPKPTRSQGDLAEMLEMLLDKGVVVNADIAVSVGDTELLGIELRAAIASFETAAEYGLEFPTGTDMERVESAANISPDQSDPASETQSETESTNPLSDDSTPTASTSAEETK |
Structure
Family & Domains
Features
Showing features for region, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 13-22 | Alpha helix 1 | ||||
Sequence: LAEMLEMLLD | ||||||
Region | 25-35 | Beta-strand 1 | ||||
Sequence: VVVNADIAVSV | ||||||
Region | 40-50 | Beta-strand 2 | ||||
Sequence: LLGIELRAAIA | ||||||
Motif | 46-50 | Conserved in GvpM1/2 but not GvpA | ||||
Sequence: RAAIA | ||||||
Region | 52-72 | Alpha helix 2 | ||||
Sequence: FETAAEYGLEFPTGTDMERVE | ||||||
Region | 63-114 | Disordered | ||||
Sequence: PTGTDMERVESAANISPDQSDPASETQSETESTNPLSDDSTPTASTSAEETK | ||||||
Compositional bias | 75-114 | Polar residues | ||||
Sequence: ANISPDQSDPASETQSETESTNPLSDDSTPTASTSAEETK | ||||||
Region | 78-87 | Alpha helix 3 | ||||
Sequence: SPDQSDPASE | ||||||
Region | 95-105 | Alpha helix 4 | ||||
Sequence: TNPLSDDSTPT |
Domain
Modeled by homology to GvpA to have 4 alpha helices and 2 beta-sheets. Extensive mutagenesis shows that most mutations in the N-terminal region (homologous to GvpA) do not make gas vesicles (PubMed:34975818).
A short motif conserved in GvpJ1/2 and GvpM1/2 (but not GvpA), which is predicted to be on the outer surface of the proteins, is important for the function of GvpJ and GvpM (PubMed:34975818).
A short motif conserved in GvpJ1/2 and GvpM1/2 (but not GvpA), which is predicted to be on the outer surface of the proteins, is important for the function of GvpJ and GvpM (PubMed:34975818).
Sequence similarities
Belongs to the gas vesicle GvpA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length114
- Mass (Da)11,983
- Last updated1992-03-01 v1
- ChecksumDC4EB22F0D55FDC0
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 75-114 | Polar residues | ||||
Sequence: ANISPDQSDPASETQSETESTNPLSDDSTPTASTSAEETK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M58557 EMBL· GenBank· DDBJ | AAA98189.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X55648 EMBL· GenBank· DDBJ | CAA39177.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF016485 EMBL· GenBank· DDBJ | AAC82802.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE004438 EMBL· GenBank· DDBJ | AAG20719.1 EMBL· GenBank· DDBJ | Genomic DNA |