P23843 · OPPA_ECOLI
- ProteinPeriplasmic oligopeptide-binding protein OppA
- GeneoppA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids543 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of the ABC transporter complex OppABCDF involved in the uptake of oligopeptides (PubMed:2187863).
Plays an important nutritional role (Probable). Binds peptides containing from two to five amino acid residues (PubMed:21983341, PubMed:3536860).
Displays a preference for tripeptides and tetrapeptides over dipeptides and pentapeptides, for peptides composed of L-amino acids and for positively charged peptides (PubMed:21983341, PubMed:3536860).
Cannot bind the cell wall peptide L-Ala-D-Gly-gamma-meso-diaminopimelic acid (PubMed:21705338).
Plays an important nutritional role (Probable). Binds peptides containing from two to five amino acid residues (PubMed:21983341, PubMed:3536860).
Displays a preference for tripeptides and tetrapeptides over dipeptides and pentapeptides, for peptides composed of L-amino acids and for positively charged peptides (PubMed:21983341, PubMed:3536860).
Cannot bind the cell wall peptide L-Ala-D-Gly-gamma-meso-diaminopimelic acid (PubMed:21705338).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing | |
Cellular Component | membrane | |
Cellular Component | outer membrane-bounded periplasmic space | |
Molecular Function | oligopeptide binding | |
Molecular Function | peptide transmembrane transporter activity | |
Biological Process | chaperone-mediated protein folding | |
Biological Process | oligopeptide import across plasma membrane | |
Biological Process | oligopeptide transport | |
Biological Process | peptide transport | |
Biological Process | protein transport | |
Biological Process | response to heat |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePeriplasmic oligopeptide-binding protein OppA
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP23843
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MTNITKRSLVAAGVLAALMAGNVALA | ||||||
Chain | PRO_0000031797 | 27-543 | Periplasmic oligopeptide-binding protein OppA | |||
Sequence: ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH | ||||||
Disulfide bond | 297↔443 | |||||
Sequence: CTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWC |
Keywords
- PTM
Proteomic databases
Interaction
Subunit
The complex is composed of two ATP-binding proteins (OppD and OppF), two transmembrane proteins (OppB and OppC) and a solute-binding protein (OppA).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length543
- Mass (Da)60,899
- Last updated1994-10-01 v2
- ChecksumBBEF9FEBD42254EF
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 271 | in Ref. 2; AAA21302 | ||||
Sequence: N → Y | ||||||
Sequence conflict | 314-315 | in Ref. 2; AAA21302 | ||||
Sequence: RV → LW | ||||||
Sequence conflict | 487-488 | in Ref. 2; AAA21302 | ||||
Sequence: QR → HG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J05433 EMBL· GenBank· DDBJ | AAA21302.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M60918 EMBL· GenBank· DDBJ | AAB00918.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U00096 EMBL· GenBank· DDBJ | AAC74325.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAA14775.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
X59501 EMBL· GenBank· DDBJ | CAA42089.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D83137 EMBL· GenBank· DDBJ | BAA11814.1 EMBL· GenBank· DDBJ | Genomic DNA |