P23654 · NRT_DROME
- ProteinNeurotactin
- GeneNrt
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids846 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May mediate or modulate cell adhesion between embryonic cells during development.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | cell adhesion receptor activity | |
Biological Process | axon guidance | |
Biological Process | axonal fasciculation | |
Biological Process | axonogenesis | |
Biological Process | central nervous system development | |
Biological Process | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameNeurotactin
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP23654
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type II membrane protein
Note: Expressed in membranes during embryogenesis.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-324 | Cytoplasmic | ||||
Sequence: MGELEEKETPPTETTAAQQEALEEPKETDKMLDKKEDAKEKTPSPQTSKPASPNAGKKSSPVAEKKIDDAELAKSKSGNGEEIIDIPAENGTKPDSADDKKISKEEREVKPKKIPIGGLKLPGFFMKNKPKADGDGAEGELLEKEKEEDKDKEANGDAATGSGKDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDADAKSEATAEATPAEDASDAPPKRGLLNAIKLPIANMIPKKKSNDDVELGLGKAGLASMETLDDSLKDQDTVDRAPVKTNGTEELKGELKDEKLAAEEKLAAEEEEQNRPVSLLTRLRGYKCSVDD | ||||||
Transmembrane | 325-346 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: ALIVFGILLFVLLLGVIGYVLT | ||||||
Topological domain | 347-846 | Extracellular | ||||
Sequence: HETLTSPPLREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYNNPLPVVVLIGAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYASLVSIISDIRSVCPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFVSAMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQPEEDYLPCNYWISKDIVPRYARVD |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000070297 | 1-846 | Neurotactin | |||
Sequence: MGELEEKETPPTETTAAQQEALEEPKETDKMLDKKEDAKEKTPSPQTSKPASPNAGKKSSPVAEKKIDDAELAKSKSGNGEEIIDIPAENGTKPDSADDKKISKEEREVKPKKIPIGGLKLPGFFMKNKPKADGDGAEGELLEKEKEEDKDKEANGDAATGSGKDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDADAKSEATAEATPAEDASDAPPKRGLLNAIKLPIANMIPKKKSNDDVELGLGKAGLASMETLDDSLKDQDTVDRAPVKTNGTEELKGELKDEKLAAEEKLAAEEEEQNRPVSLLTRLRGYKCSVDDALIVFGILLFVLLLGVIGYVLTHETLTSPPLREGRYIMAVTGCGPVEGVKEDGAFAFRGIPYAKPPVDRLRWKPAELIDDINMCWNDTLQTHNSSVVCTQRLGNGTTVGDEDCLYLDVVTPHVRYNNPLPVVVLIGAESLAGPSPGILRPSARYSRSHDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLGHRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADIQCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLVLDGDVVFEHPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGALGLTDEVIEKYNASSYASLVSIISDIRSVCPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFVSAMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQPEEDYLPCNYWISKDIVPRYARVD | ||||||
Modified residue | 28 | Phosphothreonine; by PKC | ||||
Sequence: T | ||||||
Modified residue | 42 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 44 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 47 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 48 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 52 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 75 | Phosphoserine; by PKC | ||||
Sequence: S | ||||||
Modified residue | 77 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 103 | Phosphoserine; by PKC | ||||
Sequence: S | ||||||
Modified residue | 169 | Phosphoserine; by PKC | ||||
Sequence: S | ||||||
Modified residue | 186 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 203 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 206 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 256 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 259 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 263 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 269 | Phosphothreonine | ||||
Sequence: T | ||||||
Glycosylation | 410 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 417 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 422↔437 | |||||
Sequence: CTQRLGNGTTVGDEDC | ||||||
Glycosylation | 428 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 600↔605 | |||||
Sequence: CADIQC | ||||||
Glycosylation | 636 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 691 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 720 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 738↔830 | |||||
Sequence: CPLLTNARQQPSVPFYVVTQGEGPDQLATVDADVQAILGRYEPHTVEQRRFVSAMQQLFYYYVSHGTVQSFVQNRRVINVGQDAQPEEDYLPC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Late in embryogenesis, expression is restricted to cells of the peripheral and central nervous system undergoing proliferation and differentiation. Also expressed in larval CNS, mesoderm and imaginal disks.
Developmental stage
Expressed during embryogenesis and larvae.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-222 | Disordered | ||||
Sequence: MGELEEKETPPTETTAAQQEALEEPKETDKMLDKKEDAKEKTPSPQTSKPASPNAGKKSSPVAEKKIDDAELAKSKSGNGEEIIDIPAENGTKPDSADDKKISKEEREVKPKKIPIGGLKLPGFFMKNKPKADGDGAEGELLEKEKEEDKDKEANGDAATGSGKDEQKSRPGLGERLRSFFARKPSAEKEKKQLVNGDADAKSEATAEATPAEDASDAPPKR | ||||||
Compositional bias | 20-43 | Basic and acidic residues | ||||
Sequence: EALEEPKETDKMLDKKEDAKEKTP | ||||||
Compositional bias | 61-78 | Basic and acidic residues | ||||
Sequence: PVAEKKIDDAELAKSKSG | ||||||
Compositional bias | 92-114 | Basic and acidic residues | ||||
Sequence: TKPDSADDKKISKEEREVKPKKI | ||||||
Compositional bias | 131-159 | Basic and acidic residues | ||||
Sequence: KADGDGAEGELLEKEKEEDKDKEANGDAA | ||||||
Compositional bias | 181-198 | Basic and acidic residues | ||||
Sequence: FARKPSAEKEKKQLVNGD |
Sequence similarities
In the C-terminal section; belongs to the type-B carboxylesterase/lipase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length846
- Mass (Da)92,776
- Last updated2005-06-21 v3
- ChecksumDA7AA9CC058C8300
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M9MS15 | M9MS15_DROME | Nrt | 846 |
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 20-43 | Basic and acidic residues | ||||
Sequence: EALEEPKETDKMLDKKEDAKEKTP | ||||||
Compositional bias | 61-78 | Basic and acidic residues | ||||
Sequence: PVAEKKIDDAELAKSKSG | ||||||
Compositional bias | 92-114 | Basic and acidic residues | ||||
Sequence: TKPDSADDKKISKEEREVKPKKI | ||||||
Compositional bias | 131-159 | Basic and acidic residues | ||||
Sequence: KADGDGAEGELLEKEKEEDKDKEANGDAA | ||||||
Compositional bias | 181-198 | Basic and acidic residues | ||||
Sequence: FARKPSAEKEKKQLVNGD | ||||||
Sequence conflict | 250 | in Ref. 2; CAA37831 | ||||
Sequence: G → S | ||||||
Sequence conflict | 555 | in Ref. 1; CAA38746 | ||||
Sequence: T → S | ||||||
Sequence conflict | 567 | in Ref. 1; CAA38746 | ||||
Sequence: Y → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54999 EMBL· GenBank· DDBJ | CAA38746.1 EMBL· GenBank· DDBJ | mRNA | ||
X53837 EMBL· GenBank· DDBJ | CAA37831.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF49416.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF49417.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF132188 EMBL· GenBank· DDBJ | AAD34776.1 EMBL· GenBank· DDBJ | mRNA |