P23615 · SPT6_YEAST
- ProteinTranscription elongation factor SPT6
- GeneSPT6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1451 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in maintenance of chromatin structure during RNA polymerase II transcription elongation thereby repressing transcription initiation from cryptic promoters. Mediates the reassembly of nucleosomes onto the promoters of at least a selected set of genes during repression; the nucleosome reassembly is essential for transcriptional repression. Essential for viability.
Miscellaneous
Present with 8890 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription elongation factor SPT6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP23615
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072173 | 1-1451 | Transcription elongation factor SPT6 | |||
Sequence: MEETGDSKLVPRDEEEIVNDNDETKAPSEEEEGEDVFDSSEEDEDIDEDEDEARKVQEGFIVNDDDENEDPGTSISKKRRKHKRREREEDDRLSEDDLDLLMENAGVERTKASSSSGKFKRLKRVGDEGNAAESESDNVAASRQDSTSKLEDFFSEDEEEEESGLRNGRNNEYGRDEEDHENRNRTADKGGILDELDDFIEDDEFSDEDDETRQRRIQEKKLLREQSIKQPTQITGLSSDKIDEMYDIFGDGHDYDWALEIENEELENGNDNNEAEEEEIDEETGAIKSTKKKISLQDIYDLEDLKKNLMTEGDMKIRKTDIPERYQELRAGITDYGNMSSEDQELERNWIAEKISVDKNFDANYDLTEFKEAIGNAIKFITKENLEVPFIYAYRRNYISSREKDGFLLTEDDLWDIVSLDIEFHSLVNKKDYVQRFYAELHIDDPIVTEYFKNQNTASIAELNSLQDIYDYLEFKYANEINEMFINHTGKTGKKHLKNSSYEKFKASPLYQAVSDIGISAEDVGENISSQHQIHPPVDHPSSKPVEVIESILNANSGDLQVFTSNTKLAIDTVQKYYSLELSKNTKIREKVRSDFSKYYLADVVLTAKGKKEIQKGSLYEDIKYAINRTPMHFRRDPDVFLKMVEAESLNLLSVKLHMSSQAQYIEHLFQIALETTNTSDIAIEWNNFRKLAFNQAMDKIFQDISQEVKDNLTKNCQKLVAKTVRHKFMTKLDQAPFIPNVRDPKIPKILSLTCGQGRFGADAIIAVYVNRKGDFIRDYKIVDNPFDKTNPEKFEDTLDNIIQSCQPNAIGINGPNPKTQKFYKRLQEVLHKKQIVDSRGHTIPIIYVEDEVAIRYQNSERAAQEFPNKPPLVKYCIALARYMHSPLLEYANLTSEEVRSLSIHPHQNLLSSEQLSWALETAFVDIVNLVSVEVNKATDNNYYASALKYISGFGKRKAIDFLQSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWNEKRQKYEDLEHDQLDSTRIHPEDYHLATKVAADALEYDPDTIAEKEEQGTMSEFIELLREDPDRRAKLESLNLESYAEELEKNTGLRKLNNLNTIVLELLDGFEELRNDFHPLQGDEIFQSLTGESEKTFFKGSIIPVRVERFWHNDIICTTNSEVECVVNAQRHAGAQLRRPANEIYEIGKTYPAKVIYIDYANITAEVSLLDHDVKQQYVPISYSKDPSIWDLKQELEDAEEERKLMMAEARAKRTHRVINHPYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSEKFKSGTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPGWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKSNSSKNRMNNYR | ||||||
Modified residue | 94 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 134 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 136 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 148 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 155 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 206 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 295 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with CTR9.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P23615 | SPN1 Q06505 | 8 | EBI-17947, EBI-32596 | |
BINARY | P23615 | SPT5 P27692 | 3 | EBI-17947, EBI-17937 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-24 | Basic and acidic residues | ||||
Sequence: MEETGDSKLVPRDEEEIVNDNDET | ||||||
Region | 1-217 | Disordered | ||||
Sequence: MEETGDSKLVPRDEEEIVNDNDETKAPSEEEEGEDVFDSSEEDEDIDEDEDEARKVQEGFIVNDDDENEDPGTSISKKRRKHKRREREEDDRLSEDDLDLLMENAGVERTKASSSSGKFKRLKRVGDEGNAAESESDNVAASRQDSTSKLEDFFSEDEEEEESGLRNGRNNEYGRDEEDHENRNRTADKGGILDELDDFIEDDEFSDEDDETRQRRI | ||||||
Motif | 8-12 | Nuclear localization signal | ||||
Sequence: KLVPR | ||||||
Compositional bias | 25-52 | Acidic residues | ||||
Sequence: KAPSEEEEGEDVFDSSEEDEDIDEDEDE | ||||||
Motif | 77-85 | Nuclear localization signal | ||||
Sequence: KKRRKHKRR | ||||||
Motif | 120-125 | Nuclear localization signal | ||||
Sequence: KRLKRV | ||||||
Compositional bias | 162-194 | Basic and acidic residues | ||||
Sequence: ESGLRNGRNNEYGRDEEDHENRNRTADKGGILD | ||||||
Domain | 1257-1354 | SH2 | ||||
Sequence: PYYFPFNGRQAEDYLRSKERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQIIVEYLQNKVRLLNEMTSSE |
Sequence similarities
Belongs to the SPT6 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,451
- Mass (Da)168,291
- Last updated1991-11-01 v1
- Checksum0BE9922A59BD0483
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-24 | Basic and acidic residues | ||||
Sequence: MEETGDSKLVPRDEEEIVNDNDET | ||||||
Compositional bias | 25-52 | Acidic residues | ||||
Sequence: KAPSEEEEGEDVFDSSEEDEDIDEDEDE | ||||||
Compositional bias | 162-194 | Basic and acidic residues | ||||
Sequence: ESGLRNGRNNEYGRDEEDHENRNRTADKGGILD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M34391 EMBL· GenBank· DDBJ | AAA35086.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z72899 EMBL· GenBank· DDBJ | CAA97124.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z72902 EMBL· GenBank· DDBJ | CAA97127.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006941 EMBL· GenBank· DDBJ | DAA08208.1 EMBL· GenBank· DDBJ | Genomic DNA |