P22398 · PSPC_RABIT
- ProteinSurfactant protein C
- GeneSFTPC
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids188 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
Miscellaneous
Pulmonary surfactant consists of 90% lipid and 10% protein. There are 4 surfactant-associated proteins: 2 collagenous, carbohydrate-binding glycoproteins (SP-A and SP-D) and 2 small hydrophobic proteins (SP-B and SP-C).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | alveolar lamellar body | |
Cellular Component | extracellular space | |
Biological Process | respiratory gaseous exchange by respiratory system |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSurfactant protein C
- Short namesSP-C
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Lagomorpha > Leporidae > Oryctolagus
Accessions
- Primary accessionP22398
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for propeptide, chain, lipidation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000033489 | 1-23 | ||||
Sequence: MDMGSKEALMESPPDYSAAPRGR | ||||||
Chain | PRO_0000033490 | 24-58 | Surfactant protein C | |||
Sequence: FGIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGL | ||||||
Lipidation | 28 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 29 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000033491 | 59-188 | ||||
Sequence: HMSQKHTEMVLEMSIGAPEVQQRLALSEWAGTTATFPIGSTGIVTCDYQRLLIAYKPAPGTCCYLMKMAPDSIPSLEALARKFQANPAEPPTQRGQDKGPAAGPASSGGELAFLGAAVSTLCGEVPLIYI | ||||||
Disulfide bond | 121↔180 | |||||
Sequence: CYLMKMAPDSIPSLEALARKFQANPAEPPTQRGQDKGPAAGPASSGGELAFLGAAVSTLC |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 94-188 | BRICHOS | ||||
Sequence: FPIGSTGIVTCDYQRLLIAYKPAPGTCCYLMKMAPDSIPSLEALARKFQANPAEPPTQRGQDKGPAAGPASSGGELAFLGAAVSTLCGEVPLIYI | ||||||
Region | 144-164 | Disordered | ||||
Sequence: NPAEPPTQRGQDKGPAAGPAS |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length188
- Mass (Da)19,836
- Last updated1996-10-01 v3
- ChecksumF622EEA933786F78
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 115 | in Ref. 2; AAB24761/AAB24762 | ||||
Sequence: P → PP | ||||||
Sequence conflict | 153 | in Ref. 4; AAB24576 | ||||
Sequence: G → A | ||||||
Sequence conflict | 159 | in Ref. 4; AAB24576 | ||||
Sequence: A → G | ||||||
Sequence conflict | 161 | in Ref. 1; CAA46204 | ||||
Sequence: G → R | ||||||
Sequence conflict | 186 | in Ref. 4; AAB24576 | ||||
Sequence: I → Y |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X65078 EMBL· GenBank· DDBJ | CAA46204.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
S51983 EMBL· GenBank· DDBJ | AAB24761.1 EMBL· GenBank· DDBJ | mRNA | ||
AF037445 EMBL· GenBank· DDBJ | AAC18032.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S51597 EMBL· GenBank· DDBJ | AAB24762.1 EMBL· GenBank· DDBJ | mRNA | ||
S51098 EMBL· GenBank· DDBJ | AAB24576.2 EMBL· GenBank· DDBJ | mRNA |