P22023 · KRE5_YEAST
- ProteinKiller toxin-resistance protein 5
- GeneKRE5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1365 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Required for (1->6)-beta-D-glucan synthesis and normal cell growth.
Miscellaneous
Present with 815 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum lumen | |
Molecular Function | UDP-glucose:glycoprotein glucosyltransferase activity | |
Molecular Function | unfolded protein binding | |
Biological Process | cell wall organization | |
Biological Process | ERAD pathway | |
Biological Process | fungal-type cell wall beta-glucan biosynthetic process | |
Biological Process | protein N-linked glycosylation via asparagine |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameKiller toxin-resistance protein 5
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP22023
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-17 | |||||
Sequence: MRLLALVLLLLCAPLRA | ||||||
Chain | PRO_0000021563 | 18-1365 | Killer toxin-resistance protein 5 | |||
Sequence: WTYSLRYGIPESAQVWSILVHLLGDVDNQLLTNLYPLVTGLDDEIDIQENLVALTSNVLRERYDKEDVADLLELYASLYPMGMIQHDISSNAEQDDANSSYFVLNGNRYEKPDDVFYLKSKDLTIQQKVPDVDVIQPYDVVIGTNSEAPILILYGCPTVIDSDFEEFNRNLFMEAMNGEGKFRFIWRSTCSLDGKSVEYPLTHPLEITLQNGSRMSSIPQLKKILYTVPKEILVGADNDDQLHDLEPEELRELDLRVTSLISEFYQYKKDITATLNFTKSIVNNFPLISKQLIKVSSVNKDIITSNEELNSKGFDYNMLGLYINGQNWKITSLTPYNLLTALKTEYQSLLKITNLLQELEPSKCILDSKFLLNKFSQFSLGKLQNLQPIKMDLHTIPGFSESVIYFNDIESDPQYDELVNSVQAFFDKSKFGELPEIKQNWSEIIFVIDFARLEDSEVKEALGGLVRAVNVVSQGYPQRVGLLPFSSDSDKSVVNKIYELKNSTDNLTELKSFLETMLLADGLSANAKHSKHIPVPDVFHLLDELQIDETSIIINGEIYPFRKNAWNYLIAKVIKKDTEFIRKELSNSSPKNKQISVRDLLHYKSANLRHNKYTPNYFADSVYSSVNNTALESVCSERIGYYTKNEEYNLLHTITLVDDFGSIHALKRLRNLLHTSFVGVRIRIIHVGDISDIWYQLRGSLSQKDPIGSINTFIDALKLKKVKSHTYKKSGLNQLGLHKWLPDIPLFELQKGSFIALNGRFIHLDQNEVPETEHFEAIIKREALRTIDSVFALDLLFPGFSQEIINPDLIEMISSILTRLFYQGTHIYNNGIDYTTESSLPRMDLSEFFRPNNLTMFEDGKSASIDLLLILDPLEERTQMILSLVEQFRPLKFVNIQVILMPTLELNIVPIRRIYVDDADIVKSITSEDSRSDPEVDIEMDVPNSFIVDNNYRIKKLLIELHSFSSKTVLSTGNIDGMGGVCLALVDSAGNIIDKTTTMKTFGYGQFHTDKFLKGCYIKSCDSRYTVQSFSTDGHPDFIPSDSLDILSYNPQKIAVKISEEPTHEEEYEEGRNNDTIINIFTILESGPDEEERYMQMILSILSKCPETQKVNFFILDQPFISDTLRKSCEYINSSDEMRGNVIFLNYEWPQWLRPQRFSSRRRDVSRFLFLDVLLPQNISKVLYMSPTEVPLDPFDIFQFQGLKRAPLGLFRMSGDGYWKEGYWEKMLRENNLEFYSTEPAFLVNLERFRELDAGDKYRIHYQRISTDAMSLVNIGQDLVNNLQLEVPIRFLKGSYKKKLVINDECVSEWKKKINKFASSPGDEDVPGESVSSKYQDSDNAAPLHDEL | ||||||
Glycosylation | 115 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 228 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 293 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 457 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 519 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 523 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 644 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 870 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1091 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1150 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1195 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1334-1365 | Disordered | ||||
Sequence: FASSPGDEDVPGESVSSKYQDSDNAAPLHDEL | ||||||
Motif | 1362-1365 | Prevents secretion from ER | ||||
Sequence: HDEL |
Sequence similarities
To D.melanogaster UGGG.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length1,365
- Mass (Da)156,477
- Last updated1997-11-01 v2
- ChecksumD0F5851175CC0333
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 582 | in Ref. 1; AAA34725 | ||||
Sequence: Missing | ||||||
Sequence conflict | 780-794 | in Ref. 1; AAA34725 | ||||
Sequence: HLDQNEVPETEHFEA → ILIKMKCQKQNISKAK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M33556 EMBL· GenBank· DDBJ | AAA34725.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z49821 EMBL· GenBank· DDBJ | CAA89981.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z75244 EMBL· GenBank· DDBJ | CAA99659.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA11097.1 EMBL· GenBank· DDBJ | Genomic DNA |