P21799 · CUD4_LOCMI
- ProteinEndocuticle structural glycoprotein ABD-4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids116 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the soft endocuticle of migratory locust.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chitin-based extracellular matrix | |
Molecular Function | structural constituent of chitin-based larval cuticle |
Names & Taxonomy
Protein names
- Recommended nameEndocuticle structural glycoprotein ABD-4
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Protostomia > Ecdysozoa > Panarthropoda > Arthropoda (arthropods) > Mandibulata > Pancrustacea > Hexapoda (insects) > Insecta (true insects) > Dicondylia > Pterygota (winged insects) > Neoptera > Polyneoptera > Orthoptera > Caelifera (grasshoppers and locusts) > Acrididea > Acridomorpha > Acridoidea > Acrididae (short-horned grasshoppers) > Oedipodinae (band-winged grasshoppers) > Locusta
Accessions
- Primary accessionP21799
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Chain | PRO_0000196116 | 1-116 | Endocuticle structural glycoprotein ABD-4 | |||
Sequence: QAPSDKVIPIISQNEVRNPDGSYQWNYETGNGIKADETGTLKKGSKPDEGDFIVAQGSFSYTGPDGTAYQVQYSADDENGFVPQGAHFPTPPPIPPAIQRALDYLATLPPTPEARP | ||||||
Glycosylation | 90 | O-linked (GalNAc) threonine; in ADB-4A, ABD-4B and ABD-4C | ||||
Sequence: T | ||||||
Glycosylation | 107 | O-linked (GalNAc) threonine; in ADB-4A and ABD-4B | ||||
Sequence: T | ||||||
Glycosylation | 111 | O-linked (GalNAc) threonine; in ADB-4A | ||||
Sequence: T | ||||||
Modified residue | 116 | Proline amide | ||||
Sequence: P |
Post-translational modification
3 variants exists that arise from a sequential glycosylation with N-acetylgalactosamine at three (ABD-4A), two (ABD-4B) or one (ABD-4C) threonine residues.
Keywords
- PTM
PTM databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-92 | Chitin-binding type R&R | ||||
Sequence: DGSYQWNYETGNGIKADETGTLKKGSKPDEGDFIVAQGSFSYTGPDGTAYQVQYSADDENGFVPQGAHFPTPP | ||||||
Region | 78-97 | Disordered | ||||
Sequence: ENGFVPQGAHFPTPPPIPPA |
Family and domain databases
Sequence
- Sequence statusComplete
- Length116
- Mass (Da)12,476
- Last updated1994-02-01 v3
- ChecksumE5ABF6C65E313E61
Keywords
- Technical term