P21786 · ALLT_MANSE
- ProteinAllatotropin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids204 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Neuropeptide stimulator of juvenile hormone synthesis. Cardioregulatory neurohormone that increases heart beat rate in the adult but not in the larva. Inhibits active ion transport in the midgut of feeding fourth instar and day 2 fifth instar larva, but not in the midgut of pharate or wandering fifth instar larva.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | neuropeptide hormone activity | |
Biological Process | monoatomic ion transport | |
Biological Process | negative regulation of monoatomic ion transport | |
Biological Process | neuropeptide signaling pathway | |
Biological Process | positive regulation of juvenile hormone biosynthetic process | |
Biological Process | regulation of heart rate |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAllatotropin
- Short namesAT
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Lepidoptera > Glossata > Ditrysia > Bombycoidea > Sphingidae > Sphinginae > Sphingini > Manduca
Accessions
- Primary accessionP21786
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MNLTMQLAVIVAVCLCLAEG | ||||||
Propeptide | PRO_0000020685 | 21-35 | ||||
Sequence: APDVRLTRTKQQRPT | ||||||
Peptide | PRO_0000020686 | 37-49 | Allatotropin | |||
Sequence: GFKNVEMMTARGF | ||||||
Modified residue | 49 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000020687 | 53-204 | ||||
Sequence: DRPHPRAERDVDHQAPSARPNRGTPTFKSPTVGIARDFGKRASQYGNEEEIRVTRGTFKPNSNILIARGYGKRTQLPQIDGVYGLDNFWEMLETSPEREVQEVDEKTLESIPLDWFVNEMLNNPDFARSVVRKFIDLNQDGMLSSEELLRNF |
Keywords
- PTM
Expression
Tissue specificity
Expressed extensively in the brain, frontal ganglion and terminal ganglion of the day 2 fifth instar larva (at protein level). Not expressed in the larval brain after day 4 of the fifth instar, or in the brain of the pupa or adult. Expression in the terminal ganglion is localized to cells in the posterior portion of the seventh neuromere of day 2 fifth instar larvae. In the pupa and adult expression is detected in the medial region of neuromere 6, the dorsal medial region of neuromere 7, and the posterior neuromere of the terminal ganglion (at protein level). In the frontal ganglion expression decreases in the wandering larvae and is present at low levels in during pupal ecdysis, but is not detected in the adult. Expressed in the subesophageal ganglion of day 2 fifth instar larva, but not at any time before or after day 2. Not expressed in the abdominal ganglia 1-6 of the day 2 fifth instar larva (at protein level). Expressed in the anterior neuromeres of the pterothoracic ganglion in pupa but not in adult (at protein level). Expressed in the unfused abdominal ganglia of day 10 pupae, and in pharate adult is expressed in median neurosecretory cells M1, M2 and M5, but not in median neurosecretory cells M3 and M4 (at protein level). Not expressed in the differentiated median neurosecretory cells M5 of the larva (at protein level). In the pharate adult brain isoform 3 is the predominant form, with lower levels of isoform 2 and very low levels of isoform 1 detected. In the pharate adult nerve cord isoform 3 is the predominant form, with lower levels of isoform 2 and no isoform 1 detected. In the pharate adult frontal ganglion isoform 3 is expressed, but not isoform 1 and isoform 2.
Induction
In the 5th instar larva isoform 1 is induced in the nerve cord by starvation, ingestion of the ecdysteroid agonist RH-5992 or parasitization with C.congregata.
Developmental stage
Detected in the day 2 fifth-instar larva, wandering larva, pupa and adult.
Structure
Family & Domains
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing. Additional isoforms seem to exist.
P21786-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonyms3
- Length204
- Mass (Da)23,269
- Last updated1998-12-15 v2
- ChecksumABCC6632F7C7BA0F
P21786-2
- Name2
- SynonymsP408-5
- Differences from canonical
- 61-133: RDVDHQAPSARPNRGTPTFKSPTVGIARDFGKRASQYGNEEEIRVTRGTFKPNSNILIARGYGKRTQLPQIDG → LTTSPRPWFNPKSKLLVSTRFGKRSGNEENYNEV
P21786-3
- Name3
- SynonymsPF6-1, 1
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 47-68 | Basic and acidic residues | ||||
Sequence: RGFGKRDRPHPRAERDVDHQAP | ||||||
Alternative sequence | VSP_004113 | 61 | in isoform 3 | |||
Sequence: R → L | ||||||
Alternative sequence | VSP_004112 | 61-133 | in isoform 2 | |||
Sequence: RDVDHQAPSARPNRGTPTFKSPTVGIARDFGKRASQYGNEEEIRVTRGTFKPNSNILIARGYGKRTQLPQIDG → LTTSPRPWFNPKSKLLVSTRFGKRSGNEENYNEV | ||||||
Alternative sequence | VSP_004114 | 62-134 | in isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term