P21574 · YBX2A_XENLA
- ProteinY-box-binding protein 2-A
- Geneybx2-a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids336 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a dual function in oocytes: as a DNA-binding protein, binds to the Y-box sequence (CTGATTGGCCAA) in the promoters of target genes to stimulate transcription. May also function at CCAAT-containing promoters that lack the consensus Y-box sequence. Also binds mRNA to promote accumulation of the transcripts it contributes to produce.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | ribonucleoprotein complex | |
Molecular Function | RNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | positive regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameY-box-binding protein 2-A
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionP21574
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Either free or associated with ribonucleoprotein particles.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000100227 | 1-336 | Y-box-binding protein 2-A | |||
Sequence: MSEAEAQEPEPVPQPESEPEIQKPGIAAARNQANKKVLATQVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRFAPNRRRFRRRFYRPRADTAGESGGEGVSPEQMSEGERGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNNQQNQGAEVTEQSENKDPVAPTSEALASGDDPQRPPPRRFRQRFRRPFRPRPAPQQTPEGGDGETKAESGEDPRPEPQRQRNRPYVQRRRRQGATQVAATAQGEGKAEPTQHPASEEGTPSDSPTDDGAPVQSSAPDPGIADTPAPE |
Post-translational modification
Phosphorylation activates in vitro RNA binding.
Keywords
- PTM
Expression
Tissue specificity
In adults, expression is restricted to the ovary and testis.
Developmental stage
Expressed maternally.
Gene expression databases
Interaction
Subunit
Possibly forms a heterodimer with p54 in the 6S and 15S mRNA-binding particles. The principle component of multiple messenger ribonucleoprotein (mRNP) complexes. Component of a ribonucleoprotein (RNP) complex, composed at least of elavl1/elrA and/or elavl2/elrB, igf2bp3/vg1RBP, ddx6/Xp54, ybx2/frgy2, lsm14b/rap55b and, in a subset of RNP complexes, stau1/staufen. Component of a ribonucleoprotein (RNP) complex, at least composed of lsm14a/rap55a, ybx2/frgy2, ddx6/Xp54 and eif4enif1/4E-T. Does not appear to directly bind lsm14a/rap55a. Component of a ribonucleoprotein (RNP) complex, at least composed of cpeb1, lsm14b/rap55b, ddx6/Xp54, ybx2/frgy2, pat1/P100, eif4enif1/4E-T and eif4e1b. Interaction with cpeb1 is RNA-dependent.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MSEAEAQEPEPVPQPESEPEIQ | ||||||
Domain | 44-108 | CSD | ||||
Sequence: GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANV | ||||||
Region | 103-336 | Disordered | ||||
Sequence: AEAANVTGPGGVPVKGSRFAPNRRRFRRRFYRPRADTAGESGGEGVSPEQMSEGERGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNNQQNQGAEVTEQSENKDPVAPTSEALASGDDPQRPPPRRFRQRFRRPFRPRPAPQQTPEGGDGETKAESGEDPRPEPQRQRNRPYVQRRRRQGATQVAATAQGEGKAEPTQHPASEEGTPSDSPTDDGAPVQSSAPDPGIADTPAPE | ||||||
Compositional bias | 153-167 | Basic and acidic residues | ||||
Sequence: MSEGERGEETSPQQR | ||||||
Compositional bias | 187-208 | Polar residues | ||||
Sequence: RPNNQQNQGAEVTEQSENKDPV | ||||||
Compositional bias | 253-272 | Basic and acidic residues | ||||
Sequence: ETKAESGEDPRPEPQRQRNR | ||||||
Compositional bias | 303-319 | Polar residues | ||||
Sequence: ASEEGTPSDSPTDDGAP |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P21574-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length336
- Mass (Da)37,233
- Last updated2010-02-09 v3
- ChecksumBFD5989DD86DA2FC
P21574-2
- Name2
- Differences from canonical
- 322-336: SSAPDPGIADTPAPE → VPALFHLPAALDSMGIFGTLQ
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 153-167 | Basic and acidic residues | ||||
Sequence: MSEGERGEETSPQQR | ||||||
Compositional bias | 187-208 | Polar residues | ||||
Sequence: RPNNQQNQGAEVTEQSENKDPV | ||||||
Compositional bias | 253-272 | Basic and acidic residues | ||||
Sequence: ETKAESGEDPRPEPQRQRNR | ||||||
Sequence conflict | 254 | in Ref. 4; AA sequence | ||||
Sequence: T → A | ||||||
Compositional bias | 303-319 | Polar residues | ||||
Sequence: ASEEGTPSDSPTDDGAP | ||||||
Alternative sequence | VSP_038730 | 322-336 | in isoform 2 | |||
Sequence: SSAPDPGIADTPAPE → VPALFHLPAALDSMGIFGTLQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M59454 EMBL· GenBank· DDBJ | AAA49716.1 EMBL· GenBank· DDBJ | mRNA | ||
BC155914 EMBL· GenBank· DDBJ | AAI55915.1 EMBL· GenBank· DDBJ | mRNA | ||
BC169704 EMBL· GenBank· DDBJ | AAI69704.1 EMBL· GenBank· DDBJ | mRNA | ||
BC169706 EMBL· GenBank· DDBJ | AAI69706.1 EMBL· GenBank· DDBJ | mRNA |