P21240 · CPNB1_ARATH
- ProteinChaperonin 60 subunit beta 1, chloroplastic
- GeneCPN60B1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids600 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds RuBisCO small and large subunits and is implicated in the assembly of the enzyme oligomer. Involved in protein assisted folding. Required for proper plastid division.
Miscellaneous
Assisted protein folding requires ATP hydrolysis, but not K+ ions.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Cellular Component | chloroplast | |
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast stroma | |
Cellular Component | cytosolic ribosome | |
Cellular Component | nucleus | |
Cellular Component | stromule | |
Molecular Function | ATP binding | |
Molecular Function | ATP-dependent protein folding chaperone | |
Molecular Function | mRNA binding | |
Molecular Function | protein domain specific binding | |
Biological Process | cell death | |
Biological Process | chaperone cofactor-dependent protein refolding | |
Biological Process | protein refolding | |
Biological Process | response to cold | |
Biological Process | systemic acquired resistance |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameChaperonin 60 subunit beta 1, chloroplastic
- Short namesCPN-60 beta 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP21240
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Normal germination, but chloroplast-division defect and late dwarf phenotype. Lesion formation on leaves when grown under short-day conditions. Cpn60B1 and cpn60B2 double mutant produces small albino seedlings.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 9 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-54 | Chloroplast | ||||
Sequence: MASTFTATSSIGSMVAPNGHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSAIVC | ||||||
Chain | PRO_0000005022 | 55-600 | Chaperonin 60 subunit beta 1, chloroplastic | |||
Sequence: AAKELHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAKALVTELKKMSKEVEDSELADVAAVSAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEKMSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGTLKIAALRAPGFGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGNASKVVLTKETSTIVGDGSTQDAVKKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY | ||||||
Modified residue | 101 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 478 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in leaves, stems, petioles and flowers.
Induction
Up-regulated by light. Down-regulated by wounding. Not induced by heat.
Gene expression databases
Interaction
Subunit
Part of the Cpn60 complex composed of 7 alpha and 7 beta subunits. Can also form a complex composed of 14 beta subunits only. Both complexes show ATPase activity. The Cpn60 complex interacts with the Cpn10 complex. Interacts with RAB during heat stress.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MASTFTATSSIGSMVA | ||||||
Region | 1-23 | Disordered | ||||
Sequence: MASTFTATSSIGSMVAPNGHKSD |
Sequence similarities
Belongs to the chaperonin (HSP60) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length600
- Mass (Da)63,809
- Last updated2003-01-10 v3
- Checksum78B10E9B2EE19859
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MASTFTATSSIGSMVA | ||||||
Sequence conflict | 242 | in Ref. 2; AAA32725 | ||||
Sequence: Y → H |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005223 EMBL· GenBank· DDBJ | AAD10647.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE33251.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE33252.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | ANM58183.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | ANM58184.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | ANM58185.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF386945 EMBL· GenBank· DDBJ | AAK62390.1 EMBL· GenBank· DDBJ | mRNA | ||
AY081501 EMBL· GenBank· DDBJ | AAM10063.1 EMBL· GenBank· DDBJ | mRNA | ||
AK316889 EMBL· GenBank· DDBJ | BAH19596.1 EMBL· GenBank· DDBJ | mRNA | ||
AK317612 EMBL· GenBank· DDBJ | BAH20275.1 EMBL· GenBank· DDBJ | mRNA | ||
M35598 EMBL· GenBank· DDBJ | AAA32725.1 EMBL· GenBank· DDBJ | mRNA |