P21192 · ACE2_YEAST
- ProteinMetallothionein expression activator
- GeneACE2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids770 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in regulating basal-level expression of CUP1. Activates EGT2 transcription in the absence of SWI5.
Miscellaneous
Present with 538 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | cis-regulatory region sequence-specific DNA binding | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | G1/S transition of mitotic cell cycle | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of antisense RNA transcription | |
Biological Process | positive regulation of septum digestion after cytokinesis | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMetallothionein expression activator
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP21192
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000046800 | 1-770 | Metallothionein expression activator | |||
Sequence: MDNVVDPWYINPSGFAKDTQDEEYVQHHDNVNPTIPPPDNYILNNENDDGLDNLLGMDYYNIDDLLTQELRDLDIPLVPSPKTGDGSSDKKNIDRTWNLGDENNKVSHYSKKSMSSHKRGLSGTAIFGFLGHNKTLSISSLQQSILNMSKDPQPMELINELGNHNTVKNNNDDFDHIRENDGENSYLSQVLLKQQEELRIALEKQKEVNEKLEKQLRDNQIQQEKLRKVLEEQEEVAQKLVSGATNSNSKPGSPVILKTPAMQNGRMKDNAIIVTTNSANGGYQFPPPTLISPRMSNTSINGSPSRKYHRQRYPNKSPESNGLNLFSSNSGYLRDSELLSFSPQNYNLNLDGLTYNDHNNTSDKNNNDKKNSTGDNIFRLFEKTSPGGLSISPRINGNSLRSPFLVGTDKSRDDRYAAGTFTPRTQLSPIHKKRESVVSTVSTISQLQDDTEPIHMRNTQNPTLRNANALASSSVLPPIPGSSNNTPIKNSLPQKHVFQHTPVKAPPKNGSNLAPLLNAPDLTDHQLEIKTPIRNNSHCEVESYPQVPPVTHDIHKSPTLHSTSPLPDEIIPRTTPMKITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICPCGKRFNREDALMVHRSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSPVKETIARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL | ||||||
Modified residue | 80 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 122 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 247 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 249 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 253 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 259 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 385 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 392 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 483 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 486 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 501 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 564 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 709 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 714 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P21192 | CBK1 P53894 | 3 | EBI-2073, EBI-4110 | |
BINARY | P21192 | CRM1 P30822 | 3 | EBI-2073, EBI-20589 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 77-97 | Disordered | ||||
Sequence: LVPSPKTGDGSSDKKNIDRTW | ||||||
Compositional bias | 286-308 | Polar residues | ||||
Sequence: PPPTLISPRMSNTSINGSPSRKY | ||||||
Region | 286-323 | Disordered | ||||
Sequence: PPPTLISPRMSNTSINGSPSRKYHRQRYPNKSPESNGL | ||||||
Zinc finger | 603-627 | C2H2-type 1 | ||||
Sequence: FECLYPNCNKVFKRRYNIRSHIQTH | ||||||
Zinc finger | 633-657 | C2H2-type 2 | ||||
Sequence: YSCDFPGCTKAFVRNHDLIRHKISH | ||||||
Zinc finger | 662-685 | C2H2-type 3; atypical | ||||
Sequence: YICPCGKRFNREDALMVHRSRMIC | ||||||
Region | 699-770 | Disordered | ||||
Sequence: LTSPKKSLLDSPHDTSPVKETIARDKDGSVLMKMEEQLRDDMRKHGLLDPPPSTAAHEQNSNRTLSNETDAL | ||||||
Compositional bias | 715-745 | Basic and acidic residues | ||||
Sequence: PVKETIARDKDGSVLMKMEEQLRDDMRKHGL | ||||||
Compositional bias | 752-770 | Polar residues | ||||
Sequence: TAAHEQNSNRTLSNETDAL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length770
- Mass (Da)86,634
- Last updated1991-05-01 v1
- ChecksumA7FCA8C506A2FD75
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 286-308 | Polar residues | ||||
Sequence: PPPTLISPRMSNTSINGSPSRKY | ||||||
Compositional bias | 715-745 | Basic and acidic residues | ||||
Sequence: PVKETIARDKDGSVLMKMEEQLRDDMRKHGL | ||||||
Compositional bias | 752-770 | Polar residues | ||||
Sequence: TAAHEQNSNRTLSNETDAL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M55619 EMBL· GenBank· DDBJ | AAA34387.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X91258 EMBL· GenBank· DDBJ | CAA62643.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z73303 EMBL· GenBank· DDBJ | CAA97702.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U53881 EMBL· GenBank· DDBJ | AAB82398.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006945 EMBL· GenBank· DDBJ | DAA09442.1 EMBL· GenBank· DDBJ | Genomic DNA |