P21145 · MAL_HUMAN
- ProteinMyelin and lymphocyte protein
- GeneMAL
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids153 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | hinge region between urothelial plaques of apical plasma membrane | |
Cellular Component | membrane | |
Cellular Component | membrane raft | |
Cellular Component | plasma membrane raft | |
Cellular Component | Schmidt-Lanterman incisure | |
Molecular Function | lipid binding | |
Molecular Function | peptidase activator activity involved in apoptotic process | |
Molecular Function | structural constituent of myelin sheath | |
Biological Process | apical protein localization | |
Biological Process | apoptotic process | |
Biological Process | cell differentiation | |
Biological Process | central nervous system development | |
Biological Process | central nervous system myelination | |
Biological Process | membrane raft polarization | |
Biological Process | myelination | |
Biological Process | positive regulation of extrinsic apoptotic signaling pathway via death domain receptors | |
Biological Process | protein insertion into plasma membrane | |
Biological Process | protein localization to paranode region of axon |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMyelin and lymphocyte protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP21145
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-24 | Cytoplasmic | ||||
Sequence: MAPAAATGGSTLPSGFSVFTTLPD | ||||||
Transmembrane | 25-46 | Helical | ||||
Sequence: LLFIFEFIFGGLVWILVASSLV | ||||||
Topological domain | 47-53 | Extracellular | ||||
Sequence: PWPLVQG | ||||||
Transmembrane | 54-75 | Helical | ||||
Sequence: WVMFVSVFCFVATTTLIILYII | ||||||
Topological domain | 76-92 | Cytoplasmic | ||||
Sequence: GAHGGETSWVTLDAAYH | ||||||
Transmembrane | 93-114 | Helical | ||||
Sequence: CTAALFYLSASVLEALATITMQ | ||||||
Topological domain | 115-125 | Extracellular | ||||
Sequence: DGFTYRHYHEN | ||||||
Transmembrane | 126-147 | Helical | ||||
Sequence: IAAVVFSYIATLLYVVHAVFSL | ||||||
Topological domain | 148-153 | Cytoplasmic | ||||
Sequence: IRWKSS |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 180 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000156805 | 1-153 | Myelin and lymphocyte protein | |||
Sequence: MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS |
Post-translational modification
Lipoprotein.
Keywords
- PTM
Proteomic databases
Expression
Developmental stage
Expressed in the intermediate and late stages of T-cell differentiation.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 18-151 | MARVEL | ||||
Sequence: VFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWK |
Sequence similarities
Belongs to the MAL family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
P21145-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length153
- Mass (Da)16,714
- Last updated1991-05-01 v1
- ChecksumF821FC1C0ADBE775
P21145-2
- NameB
- Differences from canonical
- 88-129: Missing
P21145-3
- NameC
- Differences from canonical
- 32-87: Missing
P21145-4
- NameD
- Differences from canonical
- 32-129: Missing
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M15800 EMBL· GenBank· DDBJ | AAA36196.1 EMBL· GenBank· DDBJ | mRNA | ||
X76678 EMBL· GenBank· DDBJ | CAA54100.1 EMBL· GenBank· DDBJ | mRNA | ||
X76679 EMBL· GenBank· DDBJ | CAA54101.1 EMBL· GenBank· DDBJ | mRNA | ||
X76680 EMBL· GenBank· DDBJ | CAA54102.1 EMBL· GenBank· DDBJ | mRNA | ||
X76681 EMBL· GenBank· DDBJ | CAA54103.1 EMBL· GenBank· DDBJ | mRNA | ||
X76220 EMBL· GenBank· DDBJ | CAA53809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X76221 EMBL· GenBank· DDBJ | CAA53809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X76222 EMBL· GenBank· DDBJ | CAA53809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X76223 EMBL· GenBank· DDBJ | CAA53809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK311844 EMBL· GenBank· DDBJ | BAG34786.1 EMBL· GenBank· DDBJ | mRNA | ||
CR541879 EMBL· GenBank· DDBJ | CAG46677.1 EMBL· GenBank· DDBJ | mRNA | ||
AC103563 EMBL· GenBank· DDBJ | AAY24121.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471219 EMBL· GenBank· DDBJ | EAX10705.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC000458 EMBL· GenBank· DDBJ | AAH00458.1 EMBL· GenBank· DDBJ | mRNA | ||
BC003006 EMBL· GenBank· DDBJ | AAH03006.1 EMBL· GenBank· DDBJ | mRNA |