P20788 · UCRI_RAT
- ProteinCytochrome b-c1 complex subunit Rieske, mitochondrial
- GeneUqcrfs1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids274 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytochrome b-c1 complex subunit Rieske, mitochondrial
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. The Rieske protein is a catalytic core subunit containing a [2Fe-2S] iron-sulfur cluster. It cycles between 2 conformational states during catalysis to transfer electrons from the quinol bound in the Q0 site in cytochrome b to cytochrome c1 (By similarity).
Incorporation of UQCRFS1 is the penultimate step in complex III assembly (By similarity).
Incorporation of UQCRFS1 is the penultimate step in complex III assembly (By similarity).
Cytochrome b-c1 complex subunit 9
Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII). UQCRFS1 undergoes proteolytic processing once it is incorporated in the complex III dimer. One of the fragments, called subunit 9, corresponds to its mitochondrial targeting sequence (MTS) (By similarity).
The proteolytic processing is necessary for the correct insertion of UQCRFS1 in the complex III dimer, but the persistence of UQCRFS1-derived fragments may prevent newly imported UQCRFS1 to be processed and assembled into complex III and is detrimental for the complex III structure and function (By similarity).
The proteolytic processing is necessary for the correct insertion of UQCRFS1 in the complex III dimer, but the persistence of UQCRFS1-derived fragments may prevent newly imported UQCRFS1 to be processed and assembled into complex III and is detrimental for the complex III structure and function (By similarity).
Miscellaneous
The Rieske protein is a high potential 2Fe-2S protein.
Catalytic activity
- a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H+(out)
Cofactor
Note: Binds 1 [2Fe-2S] cluster per subunit. Fe-S cluster delivery to the Rieske protein is mediated by components of the iron sulfur (Fe-S) cluster assembly machinery that reside in the mitochondrial matrix (including HSC20 and LYRM7) (By similarity).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 217 | [2Fe-2S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 219 | [2Fe-2S] cluster (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 236 | [2Fe-2S] cluster (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 239 | [2Fe-2S] cluster (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 241 | [2Fe-2S] cluster (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial membrane | |
Cellular Component | mitochondrial respiratory chain complex III | |
Cellular Component | mitochondrial respiratory chain complex IV | |
Cellular Component | mitochondrion | |
Cellular Component | respiratory chain complex III | |
Molecular Function | 2 iron, 2 sulfur cluster binding | |
Molecular Function | metal ion binding | |
Molecular Function | oxidoreductase activity | |
Molecular Function | protein-containing complex binding | |
Molecular Function | ubiquinol-cytochrome-c reductase activity | |
Biological Process | mitochondrial electron transport, ubiquinol to cytochrome c | |
Biological Process | mitochondrial respiratory chain complex III assembly | |
Biological Process | respiratory electron transport chain | |
Biological Process | response to hormone | |
Biological Process | response to xenobiotic stimulus |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytochrome b-c1 complex subunit Rieske, mitochondrial
- EC number
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP20788
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 79-103 | Mitochondrial matrix | ||||
Sequence: SHTDIKVPDFSDYRRAEVLDSTKSS | ||||||
Transmembrane | 104-140 | Helical | ||||
Sequence: KESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSM | ||||||
Topological domain | 141-274 | Mitochondrial intermembrane | ||||
Sequence: SASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000307248 | 1-78 | Cytochrome b-c1 complex subunit 9 | |||
Sequence: MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATVGLNVPASVRY | ||||||
Chain | PRO_0000030671 | 79-274 | Cytochrome b-c1 complex subunit Rieske, mitochondrial | |||
Sequence: SHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG | ||||||
Disulfide bond | 222↔238 | |||||
Sequence: CVPIANAGDFGGYYCPC |
Post-translational modification
Proteolytic processing is necessary for the correct insertion of UQCRFS1 in the complex III dimer. Several fragments are generated during UQCRFS1 insertion, most probably due to the endogenous matrix-processing peptidase (MPP) activity of the 2 core protein subunits UQCRC1/QCR1 and UQCRC2/QCR2, which are homologous to the 2 mitochondrial-processing peptidase (MPP) subunits beta-MPP and alpha-MPP respectively. The action of the protease is also necessary for the clearance of the UQCRFS1 fragments.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Cytochrome b-c1 complex subunit Rieske, mitochondrial
Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), a multisubunit enzyme composed of 11 subunits. The complex is composed of 3 respiratory subunits cytochrome b, cytochrome c1 and Rieske protein UQCRFS1, 2 core protein subunits UQCRC1/QCR1 and UQCRC2/QCR2, and 6 low-molecular weight protein subunits UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and subunit 9, the cleavage product of Rieske protein UQCRFS1. The complex exists as an obligatory dimer and forms supercomplexes (SCs) in the inner mitochondrial membrane with NADH-ubiquinone oxidoreductase (complex I, CI) and cytochrome c oxidase (complex IV, CIV), resulting in different assemblies (supercomplex SCI1III2IV1 and megacomplex MCI2III2IV2) (By similarity).
Incorporation of the Rieske protein UQCRFS1 is the penultimate step in complex III assembly. Interacts with TTC19, which is involved in the clearance of UQCRFS1 fragments (By similarity).
Incorporation of the Rieske protein UQCRFS1 is the penultimate step in complex III assembly. Interacts with TTC19, which is involved in the clearance of UQCRFS1 fragments (By similarity).
Cytochrome b-c1 complex subunit 9
Component of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII). Subunit 9 corresponds to the mitochondrial targeting sequence (MTS) of Rieske protein UQCRFS1. It is retained after processing and incorporated inside complex III, where it remains bound to the complex and localizes between the 2 core subunits UQCRC1/QCR1 and UQCRC2/QCR2.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 187-272 | Rieske | ||||
Sequence: EAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVV |
Sequence similarities
Belongs to the Rieske iron-sulfur protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length274
- Mass (Da)29,446
- Last updated2004-09-13 v2
- Checksum6A0E0A07E956340B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY539946 EMBL· GenBank· DDBJ | AAS66286.1 EMBL· GenBank· DDBJ | mRNA | ||
BC085339 EMBL· GenBank· DDBJ | AAH85339.1 EMBL· GenBank· DDBJ | mRNA | ||
M24542 EMBL· GenBank· DDBJ | AAA42051.1 EMBL· GenBank· DDBJ | Genomic DNA |