P20592 · MX2_HUMAN
- ProteinInterferon-induced GTP-binding protein Mx2
- GeneMX2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids715 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | microtubule | |
Cellular Component | nuclear pore | |
Cellular Component | nucleus | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | microtubule binding | |
Biological Process | defense response | |
Biological Process | defense response to virus | |
Biological Process | innate immune response | |
Biological Process | mRNA transport | |
Biological Process | protein transport | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of nucleocytoplasmic transport | |
Biological Process | response to interferon-alpha | |
Biological Process | response to virus |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Human MXB, but not other human or murine MX proteins, inhibits murine cytomegalovirus (MCMV) replication. MXB likely obstructs the nuclear entry of MCMV. Intact MXB protein containing both the nuclear localization signal and a functional GTPase domain is required for anti-MCMV function.
Names & Taxonomy
Protein names
- Recommended nameInterferon-induced GTP-binding protein Mx2
- Alternative names
Gene names
- Community suggested namesMX2; MXB.
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP20592
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 131 | Loss of GTP-binding and localization to nuclear pore. Disruption of nuclear import. | ||||
Sequence: K → A | ||||||
Mutagenesis | 151 | Defective GTP-hydrolysis. Disruption of nuclear import and cell-cycle progression. | ||||
Sequence: T → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 792 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000206598 | 1-715 | UniProt | Interferon-induced GTP-binding protein Mx2 | |||
Sequence: MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGKELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSVSSFTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEIH | |||||||
Modified residue (large scale data) | 90 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Proteomic databases
PTM databases
Expression
Induction
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P20592 | ATRIP Q8WXE1 | 3 | EBI-10200618, EBI-747353 | |
BINARY | P20592 | EHMT2 A2ABF9 | 3 | EBI-10200618, EBI-10174566 | |
BINARY | P20592 | EHMT2 Q96KQ7 | 3 | EBI-10200618, EBI-744366 | |
BINARY | P20592 | PIAS2 O75928 | 3 | EBI-10200618, EBI-348555 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 115-387 | Dynamin-type G | ||||
Sequence: DLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLP | ||||||
Region | 125-132 | G1 motif | ||||
Sequence: GDQSSGKS | ||||||
Region | 150-152 | G2 motif | ||||
Sequence: VTR | ||||||
Region | 225-228 | G3 motif | ||||
Sequence: DLPG | ||||||
Region | 294-297 | G4 motif | ||||
Sequence: TKPD | ||||||
Region | 326-329 | G5 motif | ||||
Sequence: KCRG | ||||||
Domain | 623-714 | GED | ||||
Sequence: FTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEI |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P20592-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length715
- Mass (Da)82,089
- Last updated1991-02-01 v1
- Checksum1AE4B80157545344
P20592-2
- Name2
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9J9T4 | C9J9T4_HUMAN | MX2 | 14 | ||
C9JZQ9 | C9JZQ9_HUMAN | MX2 | 129 | ||
C9JS04 | C9JS04_HUMAN | MX2 | 125 | ||
C9JEL4 | C9JEL4_HUMAN | MX2 | 133 | ||
A0A7P0Z4E8 | A0A7P0Z4E8_HUMAN | MX2 | 96 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M30818 EMBL· GenBank· DDBJ | AAA36338.1 EMBL· GenBank· DDBJ | mRNA | ||
M33883 EMBL· GenBank· DDBJ | AAA36459.1 EMBL· GenBank· DDBJ | mRNA | ||
AK298780 EMBL· GenBank· DDBJ | BAH12869.1 EMBL· GenBank· DDBJ | mRNA | ||
AL163285 EMBL· GenBank· DDBJ | CAB90555.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL773578 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471079 EMBL· GenBank· DDBJ | EAX09605.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471079 EMBL· GenBank· DDBJ | EAX09606.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC035293 EMBL· GenBank· DDBJ | AAH35293.1 EMBL· GenBank· DDBJ | mRNA |