P20338 · RAB4A_HUMAN
- ProteinRas-related protein Rab-4A
- GeneRAB4A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids218 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state (PubMed:15907487, PubMed:16034420).
Involved in protein transport (PubMed:29425100).
Plays a role in vesicular traffic. Mediates VEGFR2 endosomal trafficking to enhance VEGFR2 signaling (PubMed:29425100).
Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets (By similarity).
Involved in protein transport (PubMed:29425100).
Plays a role in vesicular traffic. Mediates VEGFR2 endosomal trafficking to enhance VEGFR2 signaling (PubMed:29425100).
Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets (By similarity).
Catalytic activity
- GTP + H2O = GDP + H+ + phosphateThis reaction proceeds in the forward direction.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic vesicle membrane | |
Cellular Component | early endosome membrane | |
Cellular Component | extracellular exosome | |
Cellular Component | insulin-responsive compartment | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | postsynaptic recycling endosome | |
Cellular Component | recycling endosome membrane | |
Cellular Component | vesicle | |
Molecular Function | G protein activity | |
Molecular Function | GDP binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | antigen processing and presentation | |
Biological Process | protein transport | |
Biological Process | Rab protein signal transduction | |
Biological Process | regulation of endocytosis | |
Biological Process | vesicle-mediated transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rab-4A
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP20338
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Early endosome membrane ; Peripheral membrane protein
Recycling endosome membrane ; Peripheral membrane protein
Note: Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 51 | 10-fold decrease in ZFYVE20 binding affinity. | ||||
Sequence: G → A | ||||||
Mutagenesis | 51 | 10-fold decrease in ZFYVE20 binding affinity. | ||||
Sequence: G → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 205 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue, lipidation.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000121093 | 1-218 | UniProt | Ras-related protein Rab-4A | |||
Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC | |||||||
Modified residue (large scale data) | 2 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 72 | UniProt | 5-glutamyl serotonin | ||||
Sequence: Q | |||||||
Modified residue | 190 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 190 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 204 | UniProt | Phosphoserine; by CDK1 | ||||
Sequence: S | |||||||
Lipidation | 216 | UniProt | S-geranylgeranyl cysteine | ||||
Sequence: C | |||||||
Modified residue | 218 | UniProt | Cysteine methyl ester | ||||
Sequence: C | |||||||
Lipidation | 218 | UniProt | S-geranylgeranyl cysteine | ||||
Sequence: C |
Post-translational modification
Phosphorylated by CDK1 kinase during mitosis.
Serotonylation of Gln-72 by TGM2 during activation and aggregation of platelets leads to constitutive activation of GTPase activity.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with SGSM1, SGSM2 and SGSM3 (By similarity).
Interacts with RAB11FIP1, RABEP1, ZFYVE20 and RUFY1 (PubMed:10698684, PubMed:11786538, PubMed:11788822, PubMed:14617813, PubMed:15280022, PubMed:16034420).
Interacts (membrane-bound form) with NDRG1; the interaction involves NDRG1 in vesicular recycling of E-cadherin (PubMed:17786215).
Interacts (in GTP-bound form) with GRIPAP1 (via N-terminus) (PubMed:20098723).
Interacts with RABEP1 and RBSN (PubMed:20098723).
Does not interact with HPS4 (By similarity).
Interacts with RABEP2; this interaction may mediate VEGFR2 cell surface expression (PubMed:29425100).
Interacts with RAB11FIP1, RABEP1, ZFYVE20 and RUFY1 (PubMed:10698684, PubMed:11786538, PubMed:11788822, PubMed:14617813, PubMed:15280022, PubMed:16034420).
Interacts (membrane-bound form) with NDRG1; the interaction involves NDRG1 in vesicular recycling of E-cadherin (PubMed:17786215).
Interacts (in GTP-bound form) with GRIPAP1 (via N-terminus) (PubMed:20098723).
Interacts with RABEP1 and RBSN (PubMed:20098723).
Does not interact with HPS4 (By similarity).
Interacts with RABEP2; this interaction may mediate VEGFR2 cell surface expression (PubMed:29425100).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P20338 | EXOC5 O00471 | 6 | EBI-722284, EBI-949824 | |
BINARY | P20338 | GARIN6 Q8NEG0 | 3 | EBI-722284, EBI-752049 | |
BINARY | P20338 | GDI1 P31150 | 8 | EBI-722284, EBI-946999 | |
BINARY | P20338 | GDI2 P50395 | 6 | EBI-722284, EBI-1049143 | |
BINARY | P20338 | GRIPAP1 Q4V328 | 4 | EBI-722284, EBI-717919 | |
BINARY | P20338 | HACE1 Q8IYU2 | 3 | EBI-722284, EBI-308277 | |
BINARY | P20338 | KCTD7 Q96MP8-2 | 3 | EBI-722284, EBI-11954971 | |
BINARY | P20338 | RABEP1 Q15276 | 3 | EBI-722284, EBI-447043 | |
BINARY | P20338 | RBSN Q9H1K0 | 4 | EBI-722284, EBI-1105310 | |
BINARY | P20338 | VPS52 Q8N1B4 | 4 | EBI-722284, EBI-2799833 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 42-50 | Effector region | ||||
Sequence: SNHTIGVEF |
Sequence similarities
Belongs to the small GTPase superfamily. Rab family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length218
- Mass (Da)24,390
- Last updated2013-03-06 v3
- Checksum983D65E1162741B0
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WYT5 | A0A087WYT5_HUMAN | RAB4A | 113 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 162 | in Ref. 1; AAA60244 | ||||
Sequence: N → D | ||||||
Sequence conflict | 208 | in Ref. 1; AAA60244 | ||||
Sequence: A → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M28211 EMBL· GenBank· DDBJ | AAA60244.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AY585832 EMBL· GenBank· DDBJ | AAT91347.1 EMBL· GenBank· DDBJ | mRNA | ||
AF498934 EMBL· GenBank· DDBJ | AAM21082.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313807 EMBL· GenBank· DDBJ | BAG36543.1 EMBL· GenBank· DDBJ | mRNA | ||
AL162595 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL117350 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471098 EMBL· GenBank· DDBJ | EAW69890.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC002438 EMBL· GenBank· DDBJ | AAH02438.1 EMBL· GenBank· DDBJ | mRNA | ||
BC004309 EMBL· GenBank· DDBJ | AAH04309.1 EMBL· GenBank· DDBJ | mRNA |