P20292 · AL5AP_HUMAN
- ProteinArachidonate 5-lipoxygenase-activating protein
- GeneALOX5AP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids161 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | membrane | |
Cellular Component | nuclear envelope | |
Cellular Component | nuclear membrane | |
Molecular Function | arachidonate 5-lipoxygenase activity | |
Molecular Function | arachidonic acid binding | |
Molecular Function | enzyme activator activity | |
Molecular Function | enzyme binding | |
Molecular Function | glutathione peroxidase activity | |
Molecular Function | glutathione transferase activity | |
Molecular Function | identical protein binding | |
Molecular Function | leukotriene-C4 synthase activity | |
Molecular Function | protein-containing complex binding | |
Biological Process | cellular response to calcium ion | |
Biological Process | leukotriene biosynthetic process | |
Biological Process | leukotriene production involved in inflammatory response | |
Biological Process | lipoxygenase pathway | |
Biological Process | positive regulation of acute inflammatory response | |
Biological Process | protein homotrimerization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameArachidonate 5-lipoxygenase-activating protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP20292
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Nucleus membrane ; Multi-pass membrane protein
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-8 | Lumenal | ||||
Sequence: MDQETVGN | ||||||
Transmembrane | 9-30 | Helical | ||||
Sequence: VVLLAIVTLISVVQNGFFAHKV | ||||||
Topological domain | 31-52 | Cytoplasmic | ||||
Sequence: EHESRTQNGRSFQRTGTLAFER | ||||||
Transmembrane | 53-77 | Helical | ||||
Sequence: VYTANQNCVDAYPTFLAVLWSAGLL | ||||||
Topological domain | 78-80 | Lumenal | ||||
Sequence: CSQ | ||||||
Transmembrane | 81-102 | Helical | ||||
Sequence: VPAAFAGLMYLFVRQKYFVGYL | ||||||
Topological domain | 103-107 | Cytoplasmic | ||||
Sequence: GERTQ | ||||||
Intramembrane | 108-115 | |||||
Sequence: STPGYIFG | ||||||
Transmembrane | 116-128 | Helical | ||||
Sequence: KRIILFLFLMSVA | ||||||
Topological domain | 129-161 | Lumenal | ||||
Sequence: GIFNYYLIFFFGSDFENYIKTISTTISPLLLIP |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Ischemic stroke (ISCHSTR)
- Note
- DescriptionA stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
- See alsoMIM:601367
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 20 | Increased affinity for the inhibitor MK-591. | ||||
Sequence: V → A | ||||||
Mutagenesis | 27 | Strongly decreased affinity for the inhibitor MK-591. | ||||
Sequence: A → V | ||||||
Mutagenesis | 30 | Strongly decreased affinity for the inhibitor MK-591. | ||||
Sequence: V → A | ||||||
Mutagenesis | 62 | Decreased affinity for the inhibitor MK-591. | ||||
Sequence: D → A | ||||||
Mutagenesis | 66 | Strongly decreased affinity for the inhibitor MK-591. | ||||
Sequence: T → A | ||||||
Mutagenesis | 112 | Strongly decreased affinity for the inhibitor MK-591. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 113 | Increased affinity for the inhibitor MK-591. | ||||
Sequence: I → A | ||||||
Mutagenesis | 116 | Strongly increased affinity for the inhibitor MK-591. | ||||
Sequence: K → A | ||||||
Mutagenesis | 123 | Decreased affinity for the inhibitor MK-591. | ||||
Sequence: F → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 175 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000217751 | 1-161 | Arachidonate 5-lipoxygenase-activating protein | |||
Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Homotrimer. Interacts with LTC4S and ALOX5.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P20292 | AQP6 Q13520 | 3 | EBI-3904621, EBI-13059134 | |
BINARY | P20292 | FFAR2 O15552 | 3 | EBI-3904621, EBI-2833872 | |
BINARY | P20292 | GPR42 O15529 | 3 | EBI-3904621, EBI-18076404 | |
BINARY | P20292 | NAPB Q9H115 | 3 | EBI-3904621, EBI-3921185 | |
BINARY | P20292 | OPRM1 P35372-10 | 3 | EBI-3904621, EBI-12807478 | |
BINARY | P20292 | Q96FB2 | 3 | EBI-3904621, EBI-2857623 | |
BINARY | P20292 | TMEM120B A0PK00 | 3 | EBI-3904621, EBI-10171534 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length161
- Mass (Da)18,157
- Last updated1992-12-01 v2
- Checksum2625F8081B9E1BAA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WW23 | A0A087WW23_HUMAN | ALOX5AP | 218 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 161 | in Ref. 1; CAA36441 | ||||
Sequence: P → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X52195 EMBL· GenBank· DDBJ | CAA36441.1 EMBL· GenBank· DDBJ | mRNA | ||
M63262 EMBL· GenBank· DDBJ | AAA35845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M60470 EMBL· GenBank· DDBJ | AAA35845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M63259 EMBL· GenBank· DDBJ | AAA35845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M63260 EMBL· GenBank· DDBJ | AAA35845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY619687 EMBL· GenBank· DDBJ | AAT38104.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL512642 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC018538 EMBL· GenBank· DDBJ | AAH18538.1 EMBL· GenBank· DDBJ | mRNA |