P20268 · HM06_CAEEL
- ProteinHomeobox protein ceh-6
- Geneceh-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids380 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Vital for embryonic development and essential for the proper function of the excretory cell (PubMed:11171402).
Required for the transdifferentiation of the Y rectal epithelial cell to the PDA motor neuron during larval development (PubMed:22493276).
Required for the transdifferentiation of the Y rectal epithelial cell to the PDA motor neuron during larval development (PubMed:22493276).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 281-340 | Homeobox | ||||
Sequence: KRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIA |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cell differentiation | |
Biological Process | multicellular organismal-level water homeostasis | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | transdifferentiation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein ceh-6
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP20268
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in defective PDA motor neuron differentiation as a result of failed Y rectal cell migration from the rectum.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000100781 | 1-380 | Homeobox protein ceh-6 | |||
Sequence: MLIPSSSSIPSSLSASASDSEPSSLNGSGISDQNILPNYHLHHHLINENEMEAANYAQVIKPTCEAFQDWPHTPMLYQQPQLHFMLPQHDWAYPHLAQSLPPPHHLTPSTAAVAAATIASQSSIINQTSVVTSTPSCQIKQEVERPEIIQRLMPPWPPAYQFSCDDSGSVSGAGGPHQPLSDISDDSEQTCPDDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADSTTGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIAPNQYDAPHPMALNNGYPMTADLFPYQAVVNHYTQQSPRQQ |
Proteomic databases
Expression
Tissue specificity
Expressed in a series of neurons in the ring ganglia, excretory cell, dividing neuroblasts in the ventral cord and rectal cells.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MLIPSSSSIPSSLSASASDSEPSSLNGSGIS | ||||||
Region | 167-190 | Disordered | ||||
Sequence: SGSVSGAGGPHQPLSDISDDSEQT | ||||||
Domain | 187-261 | POU-specific | ||||
Sequence: SEQTCPDDLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEAD | ||||||
Region | 265-286 | Disordered | ||||
Sequence: GSPNSTFEKMTGQAGRKRKKRT |
Sequence similarities
Belongs to the POU transcription factor family. Class-3 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length380
- Mass (Da)42,575
- Last updated2002-05-27 v3
- Checksum46890A452DF90A5E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF286377 EMBL· GenBank· DDBJ | AAG10298.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CAB00031.2 EMBL· GenBank· DDBJ | Genomic DNA |