P20109 · IL13_MOUSE

  • Protein
    Interleukin-13
  • Gene
    Il13
  • Status
    UniProtKB reviewed (Swiss-Prot)
  • Amino acids
  • Protein existence
    Evidence at protein level
  • Annotation score
    5/5

Function

function

Cytokine that plays important roles in allergic inflammation and immune response to parasite infection (PubMed:15361238).
Synergizes with IL2 in regulating interferon-gamma synthesis. Stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells (By similarity).
Plays an important role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1 (PubMed:34789557).
Displays the capacity to antagonize Th1-driven proinflammatory immune response and downregulates synthesis of many proinflammatory cytokines including IL1, IL6, IL10, IL12 and TNF-alpha through a mechanism that partially involves suppression of NF-kappa-B (By similarity).
Functions also on nonhematopoietic cells, including endothelial cells where it induces vascular cell adhesion protein 1/VCAM1, which is important in the recruitment of eosinophils. Exerts its biological effects through its receptors which comprises the IL4R chain and the IL13RA1 chain, to activate JAK1 and TYK2, leading to the activation of STAT6 (PubMed:34795444, PubMed:8871614).
Aside from IL13RA1, another receptor IL13RA2 acts as a high affinity decoy for IL13 and mediates internalization and depletion of extracellular IL13 (PubMed:29305434).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcytoplasm
Cellular Componentexternal side of plasma membrane
Cellular Componentextracellular space
Molecular Functioncytokine activity
Molecular Functioninterleukin-13 receptor binding
Biological Processcellular response to cytokine stimulus
Biological Processimmune response
Biological Processinflammatory response
Biological Processmicroglial cell activation
Biological Processnegative regulation of complement-dependent cytotoxicity
Biological Processnegative regulation of endothelial cell apoptotic process
Biological Processnegative regulation of inflammatory response
Biological Processnegative regulation of transforming growth factor beta production
Biological Processpositive regulation of B cell proliferation
Biological Processpositive regulation of cold-induced thermogenesis
Biological Processpositive regulation of connective tissue growth factor production
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of immunoglobulin production
Biological Processpositive regulation of interleukin-10 production
Biological Processpositive regulation of macrophage activation
Biological Processpositive regulation of mast cell degranulation
Biological Processpositive regulation of monoatomic ion transport
Biological Processpositive regulation of pancreatic stellate cell proliferation
Biological Processpositive regulation of protein secretion
Biological Processpositive regulation of release of sequestered calcium ion into cytosol
Biological Processpositive regulation of smooth muscle cell proliferation
Biological Processpositive regulation of tyrosine phosphorylation of STAT protein
Biological Processregulation of proton transport
Biological Processresponse to nicotine

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Interleukin-13
  • Short names
    IL-13
  • Alternative names
    • T-cell activation protein P600

Gene names

    • Name
      Il13
    • Synonyms
      Il-13

Organism names

  • Taxonomic identifier
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus

Accessions

  • Primary accession
    P20109

Proteomes

Organism-specific databases

Subcellular Location

Phenotypes & Variants

Disruption phenotype

Deletion mice have increased eosinophilic inflammation and splenomegaly (PubMed:29305434).
In addition, mice show exacerbated effects of IL33 administration, including increased immune cell infiltration in the peritoneum with expanded eosinophil and ILC2 populations, and reduced circulating and peritoneal sST2 (PubMed:34789557).

Variants

We now provide the "Disease & Variants" viewer in its own tab.

The viewer provides 12 variants from UniProt as well as other sources including ClinVar and dbSNP.

Go to variant viewer

PTM/Processing

Features

Showing features for signal, chain, glycosylation, disulfide bond.

TypeIDPosition(s)Description
Signal1-18
ChainPRO_000001555019-131Interleukin-13
Glycosylation42N-linked (GlcNAc...) asparagine
Disulfide bond51↔79
Glycosylation52N-linked (GlcNAc...) asparagine
Disulfide bond67↔93
Glycosylation75N-linked (GlcNAc...) asparagine

Keywords

Proteomic databases

PTM databases

Expression

Gene expression databases

Interaction

Subunit

Interacts with IL13RA2.

Binary interactions

TypeEntry 1Entry 2Number of experimentsIntact
BINARY P20109Il13ra2 O887864EBI-20559598, EBI-20260800

Protein-protein interaction databases

Miscellaneous

Structure

Family & Domains

Sequence similarities

Belongs to the IL-4/IL-13 family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Sequence processing
    The displayed sequence is further processed into a mature form.
  • Length
    131
  • Mass (Da)
    14,108
  • Last updated
    1991-02-01 v1
  • Checksum
    954F93F105713FED
MALWVTAVLALACLGGLAAPGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
M23504
EMBL· GenBank· DDBJ
AAA40149.1
EMBL· GenBank· DDBJ
mRNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp