P20065 · TYB4_MOUSE
- ProteinThymosin beta-4
- GeneTmsb4x
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Hemoregulatory peptide AcSDKP
Potent inhibitor of bone marrow derived stem cell differentiation (By similarity).
Acts by inhibits the entry of hematopoietic pluripotent stem cells into the S-phase (By similarity).
Acts by inhibits the entry of hematopoietic pluripotent stem cells into the S-phase (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | actin monomer binding | |
Biological Process | actin filament organization | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of smooth muscle cell differentiation | |
Biological Process | positive regulation of smooth muscle cell migration | |
Biological Process | regulation of cell migration | |
Biological Process | sequestering of actin monomers |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameThymosin beta-4
- Short namesT beta 4
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP20065
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, peptide, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000045923 | 1-50 | Thymosin beta-4 | |||
Sequence: MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | ||||||
Modified residue | 8 | Phosphoserine | ||||
Sequence: S | ||||||
Peptide | PRO_0000034297 | 8-11 | Hemoregulatory peptide AcSDKP | |||
Sequence: SDKP | ||||||
Modified residue | 10 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 18 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 18 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 29 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 32 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 37 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 38 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 40 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 45 | N6-acetyllysine | ||||
Sequence: K |
Post-translational modification
Hemoregulatory peptide AcSDKP
AcSDKP is inactivated by ACE, which removes the dipeptide Lys-Pro from its C-terminus.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Originally found in thymus but it is widely distributed in many tissues.
Gene expression databases
Interaction
Subunit
Identified in a complex composed of ACTA1, COBL, GSN AND TMSB4X (By similarity).
Interacts with SERPINB1 (By similarity).
Interacts with SERPINB1 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P20065 | STAB2 Q8WWQ8 | 3 | EBI-7946048, EBI-7945957 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-50 | Disordered | ||||
Sequence: MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | ||||||
Compositional bias | 11-50 | Basic and acidic residues | ||||
Sequence: PDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Sequence similarities
Belongs to the thymosin beta family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P20065-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length50
- Mass (Da)5,679
- Last updated1991-02-01 v1
- Checksum9A289F60EE48EB8A
P20065-2
- NameShort
- Differences from canonical
- 1-6: Missing
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006424 | 1-6 | in isoform Short | |||
Sequence: Missing | ||||||
Compositional bias | 11-50 | Basic and acidic residues | ||||
Sequence: PDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X16053 EMBL· GenBank· DDBJ | CAA34187.1 EMBL· GenBank· DDBJ | mRNA | ||
X16053 EMBL· GenBank· DDBJ | CAA34188.1 EMBL· GenBank· DDBJ | mRNA | ||
U38967 EMBL· GenBank· DDBJ | AAC52490.1 EMBL· GenBank· DDBJ | Genomic DNA |