P20050 · HOP1_YEAST
- ProteinMeiosis-specific protein HOP1
- GeneHOP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids605 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable constituent of the synaptonemal complex during meiosis. May interact with RED1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | condensed nuclear chromosome | |
Cellular Component | lateral element | |
Cellular Component | nucleus | |
Cellular Component | synaptonemal complex | |
Molecular Function | chromatin binding | |
Molecular Function | four-way junction DNA binding | |
Molecular Function | metal ion binding | |
Biological Process | activation of reciprocal meiotic recombination | |
Biological Process | homologous chromosome pairing at meiosis | |
Biological Process | homologous recombination | |
Biological Process | meiotic recombination checkpoint signaling | |
Biological Process | reciprocal meiotic recombination | |
Biological Process | synaptonemal complex assembly |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMeiosis-specific protein HOP1
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP20050
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Synapsis of meiotic chromosomes.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 595 | in allele HOP1-628; TS | ||||
Sequence: S → N |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000126123 | 1-605 | Meiosis-specific protein HOP1 | |||
Sequence: MSNKQLVKPKTETKTEITTEQSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVEKNYNKQNTSQNNSIKIKTLIRGKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIFLEDPTDLLENYIFSFDYDEENNVNINVNLSGNKKGSKNADPENETISLLDSRRMVQQLMRRFIIITQSLEPLPQKKFLTMRLMFNDNVDEDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLNTKHHKVALSVLSAATSSMEKAGNTNFIRVDPFDLILQQQEENKLEESVPTKPQNFVTSQTTNVLGNLLNSSQASIQPTQFVSNNPVTGICSCECGLEVPKAATVLKTCKSCRKTLHGICYGNFLHSSIEKCFTCIFGPSLDTKWSKFQDLMMIRKVFRFLVRKKKGFPASITELIDSFINVEDQNNEVKERVAFALFVFFLDETLCLDNGGKPSQTIRYVTSSVLVDVKGIVIPNTRKQLNVNHEYKWHFTTSSPKAESFYQEVLPNSRKQVESWLQDITNLRKVYSEALSPSSTLQELDLNSSLPTQDPIISGQKRRRYDLDEYLEEDKSSVVNDTIKAKDFDESVPAKIRKISVSKKTLKSNW |
Proteomic databases
PTM databases
Expression
Developmental stage
Meiosis-specific.
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P20050 | RED1 P14291 | 3 | EBI-3768303, EBI-14909 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-250 | HORMA | ||||
Sequence: EQSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVEKNYNKQNTSQNNSIKIKTLIRGKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIFLEDPTDLLENYIFSFDYDEENNVNINVNLSGNKKGSKNADPENETISLLDSRRMVQQLMRRFIIITQSLEPLPQKKFLTMRLMFNDNVDEDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLNTKHHKVALSV | ||||||
Zinc finger | 348-364 | |||||
Sequence: CKSCRKTLHGICYGNFL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length605
- Mass (Da)68,876
- Last updated1994-02-01 v2
- Checksum9ED6EA30BE41B166
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J04877 EMBL· GenBank· DDBJ | AAA34682.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z38060 EMBL· GenBank· DDBJ | CAA86151.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z37997 EMBL· GenBank· DDBJ | CAA86098.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006942 EMBL· GenBank· DDBJ | DAA08478.1 EMBL· GenBank· DDBJ | Genomic DNA |