P19182 · IFRD1_MOUSE
- ProteinInterferon-related developmental regulator 1
- GeneIfrd1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids449 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. May be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | sarcoplasm | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Biological Process | muscle cell differentiation | |
Biological Process | negative regulation of axon extension | |
Biological Process | negative regulation of collateral sprouting | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | skeletal muscle tissue regeneration | |
Biological Process | striated muscle tissue development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameInterferon-related developmental regulator 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP19182
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000153286 | 1-449 | Interferon-related developmental regulator 1 | |||
Sequence: MPKNKKRNAPHRGGGGGGGSGAATSAATAGGPHRTVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGLKNALSSKVLYEFVLERRMTLTDSIERCLKKGKSDEQRAAAAVASVLCIQLGPGFESEEILKTLGPILKKIICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECFENIFTKSYLKEKDTNVTCSTPNTVLHISSLLAWTLLLTICPINEVKKKLELHFHKLPSLLSCDDVNMRIAAGESLALLFELARGMESDFFYEDMDSLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERDFPTETVKFGPERMYIDSWVKKHTYDTFKEVLGSGMQYHLQTNEFLRNVFELGPPVMLDAATLKTMKISRFERHLYNSAAFKARTKARSKCRDKRADVGEFL |
Proteomic databases
PTM databases
Expression
Induction
By mitogens such as TPA in 373 cells and by nerve growth factor in PC12 pheochromocytoma cells.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-42 | Disordered | ||||
Sequence: MPKNKKRNAPHRGGGGGGGSGAATSAATAGGPHRTVQPFSDE |
Sequence similarities
Belongs to the IFRD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length449
- Mass (Da)49,935
- Last updated2011-07-27 v2
- Checksum01ACFC575F8AE6E8
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 43 | in Ref. 1; CAA35258 | ||||
Sequence: D → H | ||||||
Sequence conflict | 104 | in Ref. 1; CAA35258 | ||||
Sequence: L → V | ||||||
Sequence conflict | 399 | in Ref. 4; CAA24133 | ||||
Sequence: L → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X17400 EMBL· GenBank· DDBJ | CAA35258.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466526 EMBL· GenBank· DDBJ | EDL36825.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC043723 EMBL· GenBank· DDBJ | AAH43723.1 EMBL· GenBank· DDBJ | mRNA | ||
V00756 EMBL· GenBank· DDBJ | CAA24133.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |