P19073 · CDC42_YEAST
- ProteinCell division control protein 42
- GeneCDC42
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids191 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in development of cell polarity during the cell division cycle, and essential for bud emergence. Affects signaling in the pheromone-response pathway through the STE20 protein kinase. Negatively regulated by the GTPase-activating proteins RGA1, BEM3, and BEM4.
Catalytic activity
- GTP + H2O = GDP + H+ + phosphateThis reaction proceeds in the forward direction.
Features
Showing features for binding site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCell division control protein 42
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP19073
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 12 | Enhances interaction with RGA1. | ||||
Sequence: G → V | ||||||
Mutagenesis | 58 | Temperature-sensitive mutant. | ||||
Sequence: T → A | ||||||
Mutagenesis | 61 | Enhances interaction with RGA1. | ||||
Sequence: Q → L | ||||||
Mutagenesis | 71 | Temperature-sensitive mutant. | ||||
Sequence: S → P | ||||||
Mutagenesis | 97 | Temperature-sensitive mutant. | ||||
Sequence: W → R | ||||||
Mutagenesis | 118 | Dramatically reduces interaction with RGA1. | ||||
Sequence: D → A | ||||||
Mutagenesis | 142 | In CDC42-1; temperature-sensitive mutant. | ||||
Sequence: G → S | ||||||
Mutagenesis | 188 | Enhances interaction with RGA1. | ||||
Sequence: C → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000198955 | 1-188 | Cell division control protein 42 | |||
Sequence: MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKC | ||||||
Modified residue | 188 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 188 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000281285 | 189-191 | Removed in mature form | |||
Sequence: AIL |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with BEM4; the interaction is direct (PubMed:8754839).
Interacts with AXL2 (PubMed:17460121).
Interacts with RGA1 (PubMed:7498791).
Interacts with AXL2 (PubMed:17460121).
Interacts with RGA1 (PubMed:7498791).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P19073 | AIM44 Q99299 | 4 | EBI-4274, EBI-29423 | |
BINARY | P19073 | BEM1 P29366 | 4 | EBI-4274, EBI-3508 | |
BINARY | P19073 | CDC24 P11433 | 4 | EBI-4274, EBI-4220 | |
BINARY | P19073 | RDI1 Q12434 | 3 | EBI-4274, EBI-7525 | |
BINARY | P19073 | STE20 Q03497 | 6 | EBI-4274, EBI-18285 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 32-40 | Effector region | ||||
Sequence: YVPTVFDNY |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length191
- Mass (Da)21,323
- Last updated1997-11-01 v2
- Checksum30BD644BA9836B2C
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 189 | in Ref. 1; CAA36186 | ||||
Sequence: A → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X51906 EMBL· GenBank· DDBJ | CAA36186.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U19027 EMBL· GenBank· DDBJ | AAB67416.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY557933 EMBL· GenBank· DDBJ | AAS56259.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006945 EMBL· GenBank· DDBJ | DAA09547.1 EMBL· GenBank· DDBJ | Genomic DNA |