P18847 · ATF3_HUMAN
- ProteinCyclic AMP-dependent transcription factor ATF-3
- GeneATF3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids181 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter.
Isoform 2
Activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
Isoform 3
Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCyclic AMP-dependent transcription factor ATF-3
- Short namescAMP-dependent transcription factor ATF-3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP18847
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_048442 | 38 | in dbSNP:rs11571541 | |||
Sequence: T → M | ||||||
Natural variant | VAR_081532 | 168 | found in a patient with childhood apraxia of speech; uncertain significance | |||
Sequence: N → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 201 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), cross-link, modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000076581 | 1-181 | UniProt | Cyclic AMP-dependent transcription factor ATF-3 | |||
Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS | |||||||
Modified residue (large scale data) | 59 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 78 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 162 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 162 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 175 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Binds DNA as a homodimer or a heterodimer. Interacts with KAT5; promoting KAT5 autoacetylation and KAT5 deubiquitination by USP7 (PubMed:25865756).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 86-149 | bZIP | ||||
Sequence: DERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLH | ||||||
Region | 88-110 | Basic motif | ||||
Sequence: RKKRRRERNKIAAAKCRNKKKEK | ||||||
Region | 114-142 | Leucine-zipper | ||||
Sequence: LQKESEKLESVNAELKAQIEELKNEKQHL |
Sequence similarities
Belongs to the bZIP family. ATF subfamily.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
P18847-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsATF3
- Length181
- Mass (Da)20,576
- Last updated1995-11-01 v2
- ChecksumEC5D8F065EEE2D9C
P18847-2
- Name2
- SynonymsATF3-delta-Zip
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
- Differences from canonical
- 116-181: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY
P18847-3
- Name3
- SynonymsATF3-delta-Zip2a/TF3-delta-Zip2b
- Differences from canonical
- 117-181: ESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LPRPFWVQKTCIWAVDSCK
P18847-4
- Name4
- SynonymsATF3-delta-Zip2c
P18847-5
- Name5
- Differences from canonical
- 1-57: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A0MRJ2 | A0A0A0MRJ2_HUMAN | ATF3 | 153 | ||
Q5VTZ4 | Q5VTZ4_HUMAN | ATF3 | 175 |
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_046966 | 1-57 | in isoform 5 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_043182 | 14-42 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_000592 | 116-181 | in isoform 2 | |||
Sequence: KESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LQY | ||||||
Alternative sequence | VSP_043150 | 117-181 | in isoform 3 and isoform 4 | |||
Sequence: ESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS → LPRPFWVQKTCIWAVDSCK | ||||||
Sequence conflict | 132 | in Ref. 11; no nucleotide entry | ||||
Sequence: I → L |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L19871 EMBL· GenBank· DDBJ | AAA20506.1 EMBL· GenBank· DDBJ | mRNA | ||
AB066566 EMBL· GenBank· DDBJ | BAB84092.1 EMBL· GenBank· DDBJ | mRNA | ||
AB078026 EMBL· GenBank· DDBJ | BAC00495.1 EMBL· GenBank· DDBJ | mRNA | ||
AB078027 EMBL· GenBank· DDBJ | BAC00496.1 EMBL· GenBank· DDBJ | mRNA | ||
AY313927 EMBL· GenBank· DDBJ | AAP93896.1 EMBL· GenBank· DDBJ | mRNA | ||
BT006996 EMBL· GenBank· DDBJ | AAP35642.1 EMBL· GenBank· DDBJ | mRNA | ||
AY426987 EMBL· GenBank· DDBJ | AAQ93358.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK312998 EMBL· GenBank· DDBJ | BAG35834.1 EMBL· GenBank· DDBJ | mRNA | ||
DA589280 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
CR450334 EMBL· GenBank· DDBJ | CAG29330.1 EMBL· GenBank· DDBJ | mRNA | ||
AC092803 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590648 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL606913 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471100 EMBL· GenBank· DDBJ | EAW93385.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471100 EMBL· GenBank· DDBJ | EAW93386.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471100 EMBL· GenBank· DDBJ | EAW93387.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471100 EMBL· GenBank· DDBJ | EAW93388.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC006322 EMBL· GenBank· DDBJ | AAH06322.1 EMBL· GenBank· DDBJ | mRNA |