P18027 · CAPSD_CMVY
- ProteinCapsid protein
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids218 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Capsid protein. Probably binds RNA and plays a role in packaging (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ribonucleoprotein complex | |
Cellular Component | T=3 icosahedral viral capsid | |
Cellular Component | viral nucleocapsid | |
Molecular Function | RNA binding | |
Molecular Function | structural molecule activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameCapsid protein
- Short namesCP
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Kitrinoviricota > Alsuviricetes > Martellivirales > Bromoviridae > Cucumovirus > Cucumber mosaic virus
- Virus hosts
Accessions
- Primary accessionP18027
- Secondary accessions
Subcellular Location
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine; by host | ||||
Sequence: M | ||||||
Chain | PRO_0000083222 | 1-218 | Capsid protein | |||
Sequence: MDKSESTSAGRNRRRRLRRGSRSASSSSDANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCKPGYTFTSITLRPPKIDRESYYGKRLLLPDSVMEYDKKLVSRIQIRVNPLPKFDSTVWVTVRKVSASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADIGDMRKYAVLVYSKDDTLETDELVLHVDVEHQRIPTSGVLPV |
Keywords
- PTM
PTM databases
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MDKSESTSAGRNRRRRLRRGSRSASSSSDA |
Domain
The N-terminal arginine-rich stretch does not seem to be the major RNA-binding region that allows formation of an infectious ribonucleoprotein complex.
Sequence similarities
Belongs to the cucumovirus capsid protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length218
- Mass (Da)24,271
- Last updated1998-12-15 v2
- Checksum18FEC8489996E9AF
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 6 | in Ref. 4; AAA46407 | ||||
Sequence: S → P | ||||||
Sequence conflict | 76 | in Ref. 2; AAA46420/BAA02061 | ||||
Sequence: R → K | ||||||
Sequence conflict | 83 | in Ref. 2; AAA46420/BAA02061 | ||||
Sequence: E → G | ||||||
Sequence conflict | 97 | in Ref. 2; AAA46420/BAA02061 | ||||
Sequence: M → T | ||||||
Sequence conflict | 193 | in Ref. 2; AAA46420/BAA02061 | ||||
Sequence: T → A |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M22710 EMBL· GenBank· DDBJ | AAA46408.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
M57602 EMBL· GenBank· DDBJ | AAA46420.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
D12499 EMBL· GenBank· DDBJ | BAA02061.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
D83958 EMBL· GenBank· DDBJ | BAA12152.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
M29129 EMBL· GenBank· DDBJ | AAA46407.1 EMBL· GenBank· DDBJ | mRNA |