P17919 · HXB1_MOUSE
- ProteinHomeobox protein Hox-B1
- GeneHoxb1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids297 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 199-258 | Homeobox | ||||
Sequence: PGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKRE |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein Hox-B1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP17919
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000200108 | 1-297 | Homeobox protein Hox-B1 | |||
Sequence: MDYNRMSSFLEYPLCNRGPSAYSAPTSFPPCSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSSYGAQLGGLPDSYGAGGVGSGPYPPPQPPYGTEQTATFASAYDLLSEDKESPCSSEPSTLTPRTFDWMKVKRNPPKTAKVSELGLGAPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPEASPSSITS |
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed along the entire length of the primitive streak. In early neurogenesis it is expressed in lateral and paraxial mesoderm, endoderm and superficial ectoderm or in the neural tube. From late neurogenesis to mid-embryogenesis, it presents similar spatial domains in the lateral mesoderm, endoderm and superficial ectoderm but is not detectable in the posterior hindbrain and has increased dramatically in rhombomere 4.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 38-74 | Disordered | ||||
Sequence: SYAGESRYGGGLPSSALQQNSGYPVQQPPSSLGVSFP | ||||||
Compositional bias | 49-74 | Polar residues | ||||
Sequence: LPSSALQQNSGYPVQQPPSSLGVSFP | ||||||
Region | 124-144 | Disordered | ||||
Sequence: YGAGGVGSGPYPPPQPPYGTE | ||||||
Motif | 175-180 | Antp-type hexapeptide | ||||
Sequence: TFDWMK | ||||||
Region | 251-297 | Disordered | ||||
Sequence: RMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPEASPSSITS | ||||||
Compositional bias | 280-297 | Polar residues | ||||
Sequence: SDQSACTSPEASPSSITS |
Sequence similarities
Belongs to the Antp homeobox family. Labial subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length297
- Mass (Da)31,672
- Last updated1990-11-01 v1
- Checksum9798C2B4E897C324
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 38 | in Ref. 2; CAA42078 | ||||
Sequence: S → T | ||||||
Compositional bias | 49-74 | Polar residues | ||||
Sequence: LPSSALQQNSGYPVQQPPSSLGVSFP | ||||||
Sequence conflict | 162 | in Ref. 2; CAA42078 | ||||
Sequence: S → C | ||||||
Sequence conflict | 198 | in Ref. 2 | ||||
Sequence: A → P | ||||||
Sequence conflict | 200 | in Ref. 2 | ||||
Sequence: G → R | ||||||
Sequence conflict | 217 | in Ref. 3; BAB30874 | ||||
Sequence: E → G | ||||||
Sequence conflict | 234 | in Ref. 2; CAA42078 | ||||
Sequence: A → P | ||||||
Compositional bias | 280-297 | Polar residues | ||||
Sequence: SDQSACTSPEASPSSITS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X53063 EMBL· GenBank· DDBJ | CAA37238.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X59474 EMBL· GenBank· DDBJ | CAA42078.1 EMBL· GenBank· DDBJ | mRNA | ||
AK017686 EMBL· GenBank· DDBJ | BAB30874.1 EMBL· GenBank· DDBJ | mRNA | ||
BC103597 EMBL· GenBank· DDBJ | AAI03598.1 EMBL· GenBank· DDBJ | mRNA | ||
BC103598 EMBL· GenBank· DDBJ | AAI03599.1 EMBL· GenBank· DDBJ | mRNA | ||
BC103606 EMBL· GenBank· DDBJ | AAI03607.1 EMBL· GenBank· DDBJ | mRNA | ||
M34005 EMBL· GenBank· DDBJ | AAA37850.1 EMBL· GenBank· DDBJ | Genomic DNA |