P17903 · RSBV_BACSU
- ProteinAnti-sigma-B factor antagonist
- GenersbV
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids109 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Positive regulator of sigma-B activity. Non-phosphorylated RsbV binds to RsbW, preventing its association with sigma-B. When phosphorylated, releases RsbW, which is then free to complex with and inactivate sigma-B.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | anti-sigma factor antagonist activity |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAnti-sigma-B factor antagonist
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Bacillaceae > Bacillus
Accessions
- Primary accessionP17903
Proteomes
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 56 | Loss of phosphorylation. Interacts strongly with RsbW. | ||||
Sequence: S → A | ||||||
Mutagenesis | 56 | No interaction with RsbW. | ||||
Sequence: S → D |
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000194185 | 1-109 | Anti-sigma-B factor antagonist | |||
Sequence: MNINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLGVFVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDISAKSEGGVQ | ||||||
Modified residue | 52 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 56 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 57 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylated by RsbW on a serine residue. Dephosphorylated by RsbP or RsbU.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Monomer (Probable). In stressed cells, forms a complex with RsbW. The predominant form of this complex has a stoichiometry of 2:2 (one dimer of RsbW is bound by two monomers of RsbV). Binds to RsbW in the presence of low levels of ATP or under conditions of energy or environmental stress (through dephosphorylation by RsbP or RsbU).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-109 | STAS | ||||
Sequence: INVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLRICLKDVSYMDSTGLGVFVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDISAKSEGGVQ |
Sequence similarities
Belongs to the anti-sigma-factor antagonist family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length109
- Mass (Da)11,939
- Last updated1990-11-01 v1
- Checksum12CB03E940463F2C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M34995 EMBL· GenBank· DDBJ | AAA22711.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L35574 EMBL· GenBank· DDBJ | AAA85084.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB001488 EMBL· GenBank· DDBJ | BAA19308.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL009126 EMBL· GenBank· DDBJ | CAB12278.1 EMBL· GenBank· DDBJ | Genomic DNA |