P17780 · TGB1_PVXX3
- ProteinMovement and silencing protein TGBp1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids226 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Increases plasmodesma size exclusion limit. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.
Miscellaneous
TGBp1, TGBp2 and TGBp3 seem to act together for cell-to-cell propagation. TGBp1 is the main movement protein that physically cross the plasmodesma with the viral genome. TGBp2 and TGBp3 would facilitate TGBp1 function.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | RNA binding | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | transport of virus in host, cell to cell | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMovement and silencing protein TGBp1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Kitrinoviricota > Alsuviricetes > Tymovirales > Alphaflexiviridae > Potexvirus > Potato virus X
- Virus hosts
Accessions
- Primary accessionP17780
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000222573 | 1-226 | Movement and silencing protein TGBp1 | |||
Sequence: MDILISSLKSLGYSRTSKSLDSGPLVVHAVAGAGKSTALRKLILRHPTFTVHTLGVPDKVSIRTRGIQKPGPIPEGNFAILDEYTLDNTTRNSYQALFADPYQAPEFSLEPHFYLETSFRVPRKVADLIAGCGFDFETNSQEEGHLEITGIFKGPLLGKVIAIDEESETTLSRHGVEFVKPCQVTGLELKVVTIVSAAPIEEIGQSTAFYNAITRSKGLTYVRAGT |
Interaction
Subunit
Homodimer and homooligomer. Interacts with capsid protein. Interacts with host AGO1; this interaction targets the host protein for degradation, thereby suppressing the antiviral RNA silencing.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-115 | +RNA virus helicase ATP-binding | ||||
Sequence: MDILISSLKSLGYSRTSKSLDSGPLVVHAVAGAGKSTALRKLILRHPTFTVHTLGVPDKVSIRTRGIQKPGPIPEGNFAILDEYTLDNTTRNSYQALFADPYQAPEFSLEPHFYL | ||||||
Domain | 116-226 | +RNA virus helicase C-terminal | ||||
Sequence: ETSFRVPRKVADLIAGCGFDFETNSQEEGHLEITGIFKGPLLGKVIAIDEESETTLSRHGVEFVKPCQVTGLELKVVTIVSAAPIEEIGQSTAFYNAITRSKGLTYVRAGT |
Sequence similarities
Belongs to the Tymovirales TGBp1 protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length226
- Mass (Da)24,596
- Last updated1990-08-01 v1
- ChecksumC9CD64335D061931
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D00344 EMBL· GenBank· DDBJ | BAA00250.1 EMBL· GenBank· DDBJ | Genomic RNA |