P17362 · PG029_VACCW
- ProteinIFN signaling evasion protein OPG029
- GeneOPG029
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids151 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Prevents establishment of cellular antiviral state by blocking virus-induced phosphorylation and activation of interferon regulatory factors 3/IRF3 and 7/IRF7, transcription factors critical for the induction of interferons alpha and beta. This blockage is produced through the inhibition of host TBK1, by binding host TBK1 adapter proteins TBKBP1 and AZI2, thereby producing a strong inhibition of the phosphorylation and activation of IRF3 and IRF7. Acts also as an inhibitor of the cellular response to type I IFN by interacting with host STAT2. Mechanistically, exerts its inhibitory effect after host ISGF3 complex (composed of STAT1, STAT2 and IRF9) binding to the interferon stimulated response element (ISRE).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Cellular Component | nucleus | |
Molecular Function | protein sequestering activity | |
Biological Process | suppression by virus of host type I interferon production | |
Biological Process | symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of TBK1 activity | |
Biological Process | symbiont-mediated suppression of host toll-like receptor signaling pathway | |
Biological Process | symbiont-mediated suppression of host type I interferon-mediated signaling pathway |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameIFN signaling evasion protein OPG029
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Nucleocytoviricota > Pokkesviricetes > Chitovirales > Poxviridae > Chordopoxvirinae > Orthopoxvirus > Vaccinia virus
- Virus hosts
Accessions
- Primary accessionP17362
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000099384 | 1-151 | IFN signaling evasion protein OPG029 | |||
Sequence: MNAYNKADSFSLESDSIKDVIHDYICWLSMTDEMRPSIGNVFKAMETFKIDAVRYYDGNIYELAKDINAMSFDGFIRSLQTIASKKDKLTVYGTMGLLSIVVDINKGCDISNIKFAAGIIILMEYIFDDTDMSHLKVALYRRIQRRDDVDR |
Expression
Induction
Expressed in the early phase of the viral replicative cycle.
Keywords
- Developmental stage
Interaction
Subunit
Interacts with host TANK, TBKBP1 and AZI2; these interactions prevent interferon production (PubMed:21931555).
Interacts with host STAT2 (PubMed:27907166).
Interacts with host STAT2 (PubMed:27907166).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P17362 | AZI2 Q9H6S1 | 2 | EBI-9519257, EBI-359973 | |
XENO | P17362 | TANK Q92844 | 2 | EBI-9519257, EBI-356349 | |
XENO | P17362 | TBKBP1 A7MCY6 | 2 | EBI-9519257, EBI-359969 |
Protein-protein interaction databases
Family & Domains
Sequence
- Sequence statusComplete
- Length151
- Mass (Da)17,322
- Last updated1990-08-01 v1
- Checksum27E1BD3C222AF5DE
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M22812 EMBL· GenBank· DDBJ | AAA69602.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY243312 EMBL· GenBank· DDBJ | AAO89301.1 EMBL· GenBank· DDBJ | Genomic DNA |