P16437 · FLGB_SALTY
- ProteinFlagellar basal body rod protein FlgB
- GeneflgB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids138 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Structural component of flagellum, the bacterial motility apparatus. Part of the rod structure of flagellar basal body.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | bacterial-type flagellum basal body, rod | |
Biological Process | bacterial-type flagellum-dependent swarming motility |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFlagellar basal body rod protein FlgB
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Salmonella
Accessions
- Primary accessionP16437
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Defects in flagellar assembly process.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000180792 | 1-138 | Flagellar basal body rod protein FlgB | |||
Sequence: MLDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKVMVRGREETGGVALTLTSSHHIPAQAVSSPAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKGMMNVLQGGN |
Proteomic databases
Interaction
Subunit
The basal body constitutes a major portion of the flagellar organelle and consists of a number of rings mounted on a central rod. In Gram-negative bacteria, at least four rings, L, P, S and M are present, whereas Gram-positive bacteria lack the L and P rings. The rod consists of about 26 subunits of FlgG in the distal portion, and FlgB, FlgC and FlgF build up the proximal portion of the rod with about 6 subunits each. Rod assembly occurs by export via the flagellum-specific pathway of its constituent proteins and by their incorporation into the rod structure in the probable order of FlgB, FlgC, FlgF and FlgG. Another protein, FliE, also assembles onto the stable rod structure. Interacts with FliE and peptidoglycan hydrolase FlgJ (via N-terminus), which seems to function as a scaffold or cap for rod assembly.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length138
- Mass (Da)15,129
- Last updated2007-01-23 v2
- Checksum5964A5B727BE3770
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X52093 EMBL· GenBank· DDBJ | CAA36309.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D13703 EMBL· GenBank· DDBJ | BAA02861.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE006468 EMBL· GenBank· DDBJ | AAL20104.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
D25292 EMBL· GenBank· DDBJ | BAA21014.1 EMBL· GenBank· DDBJ | Genomic DNA |