P16382 · IL4RA_MOUSE
- ProteinInterleukin-4 receptor subunit alpha
- GeneIl4r
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids810 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Miscellaneous
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-4 receptor subunit alpha
- Short namesIL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA
- Cleaved into 1 chains
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP16382
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Isoform 2
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 26-233 | Extracellular | ||||
Sequence: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR | ||||||
Transmembrane | 234-257 | Helical | ||||
Sequence: LPLGVTISCLCIPLFCLFCYFSIT | ||||||
Topological domain | 258-810 | Cytoplasmic | ||||
Sequence: KIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKYPHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVSVVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLEAENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQSAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSSGPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGDPGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPSPLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHLKQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSNLSGEGKGPGHSPVPSQTTEVPVGALGIAVS |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 59 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: C → R | ||||||
Natural variant | 74 | in strain: BALB/c, AKR/J and SJL/J; reduced IL4-neutralizing capacity of soluble form | ||||
Sequence: T → I | ||||||
Natural variant | 193 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: M → T | ||||||
Natural variant | 334 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: L → P | ||||||
Natural variant | 374 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: N → S | ||||||
Natural variant | 382 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: I → M | ||||||
Natural variant | 472 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: G → D | ||||||
Natural variant | 626 | in strain: BALB/c, AKR/J and SJL/J | ||||
Sequence: D → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 69 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MGRLCTKFLTSVGCLILLLVTGSGS | ||||||
Chain | PRO_0000010890 | 26-? | Soluble interleukin-4 receptor subunit alpha | |||
Sequence: MGRLCTKFLTSVGCLILLLVTGSGS | ||||||
Chain | PRO_0000010889 | 26-810 | Interleukin-4 receptor subunit alpha | |||
Sequence: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQRLPLGVTISCLCIPLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKYPHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVSVVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLEAENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQSAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSSGPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGDPGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPSPLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHLKQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSNLSGEGKGPGHSPVPSQTTEVPVGALGIAVS | ||||||
Disulfide bond | 34↔44 | |||||
Sequence: CFSDYIRTSTC | ||||||
Glycosylation | 72 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 75↔87 | |||||
Sequence: CIPRNSASTVCVC | ||||||
Glycosylation | 129 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 135 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 163 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 165 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 500 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 575 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 603 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 631 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with PIK3C3 (PubMed:8390454).
Interacts with JAK1 through a Box 1-containing region; inhibited by SOCS5 (PubMed:12242343).
Interacts with SOCS5; inhibits IL4 signaling (PubMed:12242343).
Interacts with CLM1 (PubMed:26124135).
Interacts with IL13RA2 (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 126-224 | Fibronectin type-III | ||||
Sequence: APDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYN | ||||||
Motif | 213-217 | WSXWS motif | ||||
Sequence: WSEWS | ||||||
Motif | 263-271 | Box 1 motif | ||||
Sequence: WWDQIPTPA | ||||||
Region | 441-557 | Required for IRS1 activation and IL4-induced cell growth | ||||
Sequence: GSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQSAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSSGPPMQPVESWEQILHMS | ||||||
Region | 460-482 | Disordered | ||||
Sequence: ATCQVTEQPSHPGPLSGSPAQSA | ||||||
Region | 510-546 | Disordered | ||||
Sequence: APNPGELAPEQQQADHLEEEEPPSPADPHSSGPPMQP | ||||||
Region | 557-653 | Required for IL4-induced gene expression | ||||
Sequence: SVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGDPGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGL | ||||||
Region | 586-672 | Disordered | ||||
Sequence: AAQDPGVPGVRPSGDPGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPSPLNSDPPKSPPE | ||||||
Compositional bias | 635-662 | Polar residues | ||||
Sequence: QNPVPNQSPSSVPLFTFGLDTELSPSPL | ||||||
Motif | 707-712 | ITIM motif | ||||
Sequence: IVYSSL | ||||||
Region | 766-810 | Disordered | ||||
Sequence: PPEANLMSAPKTPSNLSGEGKGPGHSPVPSQTTEVPVGALGIAVS |
Domain
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
P16382-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsMembrane
- NoteBinds IL-4.
- Length810
- Mass (Da)87,627
- Last updated1990-08-01 v1
- Checksum536B9E01E938FF6D
P16382-2
- Name2
- SynonymsSecreted
- NoteBinds IL-4.
P16382-3
- Name3
- NoteLacks the cytoplasmic domain. Binds IL4.
- Differences from canonical
- 258-810: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0U1RPZ6 | A0A0U1RPZ6_MOUSE | Il4ra | 42 | ||
A0A0U1RNW1 | A0A0U1RNW1_MOUSE | Il4ra | 140 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_001675 | 225-230 | in isoform 2 | |||
Sequence: HFQLPL → PSNENL | ||||||
Alternative sequence | VSP_001676 | 231-810 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_001677 | 258-810 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 436 | in Ref. 5; BAC28718 | ||||
Sequence: S → C | ||||||
Compositional bias | 635-662 | Polar residues | ||||
Sequence: QNPVPNQSPSSVPLFTFGLDTELSPSPL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M27959 EMBL· GenBank· DDBJ | AAA39299.1 EMBL· GenBank· DDBJ | mRNA | ||
M27960 EMBL· GenBank· DDBJ | AAA39300.1 EMBL· GenBank· DDBJ | mRNA | ||
M29854 EMBL· GenBank· DDBJ | AAA39297.1 EMBL· GenBank· DDBJ | mRNA | ||
M64879 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64870 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64871 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64872 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64873 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64874 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64876 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64877 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M64878 EMBL· GenBank· DDBJ | AAB59727.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF000304 EMBL· GenBank· DDBJ | AAB87750.1 EMBL· GenBank· DDBJ | mRNA | ||
AK034466 EMBL· GenBank· DDBJ | BAC28718.1 EMBL· GenBank· DDBJ | mRNA | ||
AK088086 EMBL· GenBank· DDBJ | BAC40137.1 EMBL· GenBank· DDBJ | mRNA |