P16241 · CF1A_DROME
- ProteinPOU domain protein CF1A
- Genevvl
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids427 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Binds to a DNA sequence element required for the expression of the dopa decarboxylase gene (Ddc) in specific dopaminergic neurons. Could also play an early role in specific ectodermal cells, and a subsequent role in the embryonic nervous system.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 304-363 | Homeobox | ||||
Sequence: KRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMT |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Biological Process | brain development | |
Biological Process | brain segmentation | |
Biological Process | dendrite morphogenesis | |
Biological Process | motor neuron axon guidance | |
Biological Process | peripheral nervous system development | |
Biological Process | positive regulation of antimicrobial peptide biosynthetic process | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of dendrite morphogenesis | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePOU domain protein CF1A
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP16241
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000100774 | 1-427 | POU domain protein CF1A | |||
Sequence: MAATSYMTPPSGDLDMALGGGGYHTSSPRSAADAGEMKYMQHHHHHHAAAAAAAHHQLPSSPSPNGQGNGGGLGLGSGSGLGSWSALHPDPWMQTHHTHHLPAAAAVASAADTVKQEMSHLSQQTRIQQGMASPHAAWHAPHAGHYAPTGGSPLQYHHAMNGMLHHPAHAVAAAHHQSVAPLHHTLRGESPQLHIHHHMGGGDRDAISGGEEDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADSTTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPNTLGGDMMDGMPPGHMHHGGYHPHHDMHGSPMGTHSHSHSPPMLSPQNMQSSAVAAHQLAAH |
Proteomic databases
Expression
Tissue specificity
Coexpressed with acj6 in overlapping subsets of neurons in the embryonic epidermis and central nervous system. First detected in the precursor of the tracheal pits and the stomodeal invagination and later in the peripheral nervous system.
Developmental stage
Expressed at maximal levels in early embryos (6-12 hours). Expressed at lower levels during development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 39-77 | Disordered | ||||
Sequence: YMQHHHHHHAAAAAAAHHQLPSSPSPNGQGNGGGLGLGS | ||||||
Compositional bias | 58-72 | Polar residues | ||||
Sequence: LPSSPSPNGQGNGGG | ||||||
Compositional bias | 196-211 | Basic and acidic residues | ||||
Sequence: HHHMGGGDRDAISGGE | ||||||
Region | 196-217 | Disordered | ||||
Sequence: HHHMGGGDRDAISGGEEDTPTS | ||||||
Domain | 212-286 | POU-specific | ||||
Sequence: EDTPTSDDLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEAD | ||||||
Region | 288-309 | Disordered | ||||
Sequence: TTGSPTSIDKIAAQGRKRKKRT | ||||||
Region | 390-427 | Disordered | ||||
Sequence: HDMHGSPMGTHSHSHSPPMLSPQNMQSSAVAAHQLAAH | ||||||
Compositional bias | 398-420 | Polar residues | ||||
Sequence: GTHSHSHSPPMLSPQNMQSSAVA |
Sequence similarities
Belongs to the POU transcription factor family. Class-3 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length427
- Mass (Da)45,927
- Last updated2003-01-10 v5
- Checksum161F40CF3DBB8BF7
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0S0WNN1 | A0A0S0WNN1_DROME | vvl | 726 | ||
A0A0S0WGV5 | A0A0S0WGV5_DROME | vvl | 742 | ||
E1JI48 | E1JI48_DROME | vvl | 713 | ||
A8E6G8 | A8E6G8_DROME | vvl | 427 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 58-72 | Polar residues | ||||
Sequence: LPSSPSPNGQGNGGG | ||||||
Sequence conflict | 83-102 | in Ref. 6; CAA36496 | ||||
Sequence: SWSALHPDPWMQTHHTHHLP → LMECPPSGSVDANPSYAPSA | ||||||
Sequence conflict | 130-140 | in Ref. 6; CAA36496 | ||||
Sequence: GMASPHAAWHA → ACLAPCRLAC | ||||||
Sequence conflict | 147 | in Ref. 6; CAA36496 | ||||
Sequence: A → G | ||||||
Sequence conflict | 169 | in Ref. 5; AAO39521 | ||||
Sequence: H → N | ||||||
Compositional bias | 196-211 | Basic and acidic residues | ||||
Sequence: HHHMGGGDRDAISGGE | ||||||
Sequence conflict | 364-375 | in Ref. 6; CAA36496 | ||||
Sequence: PPNTLGGDMMDG → AKYARRRHDGR | ||||||
Compositional bias | 398-420 | Polar residues | ||||
Sequence: GTHSHSHSPPMLSPQNMQSSAVA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X58435 EMBL· GenBank· DDBJ | CAA41341.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
M81959 EMBL· GenBank· DDBJ | AAA28831.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF50641.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT003517 EMBL· GenBank· DDBJ | AAO39521.1 EMBL· GenBank· DDBJ | mRNA | ||
X52252 EMBL· GenBank· DDBJ | CAA36496.1 EMBL· GenBank· DDBJ | Genomic DNA |