P16033 · PSBA2_SYNY3
- ProteinPhotosystem II protein D1 2
- GenepsbA2; psbA3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids360 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors.
Miscellaneous
Cyanobacteria usually contain more than 2 copies of the psbA gene.
2 of the reaction center chlorophylls (ChlD1 and ChlD2) are entirely coordinated by water.
Herbicides such as atrazine, BNT, diuron or ioxynil bind in the Q(B) binding site and block subsequent electron transfer.
Catalytic activity
- 2 a plastoquinone + 2 H2O + 4 hnu = 2 a plastoquinol + O2
2 a plastoquinone RHEA-COMP:9562 + 2 CHEBI:15377 + 4 CHEBI:30212 = 2 a plastoquinol RHEA-COMP:9561 + CHEBI:15379
Cofactor
Note: The D1/D2 heterodimer binds P680, chlorophylls that are the primary electron donor of PSII, and subsequent electron acceptors. It shares a non-heme iron and each subunit binds pheophytin, quinone, additional chlorophylls, carotenoids and lipids. D1 provides most of the ligands for the Mn4-Ca-O5 cluster of the oxygen-evolving complex (OEC). There is also a Cl-1 ion associated with D1 and D2, which is required for oxygen evolution. The PSII complex binds additional chlorophylls, carotenoids and specific lipids.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 118 | Mg (UniProtKB | ChEBI) of chlorophyll a ChlzD1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 126 | pheophytin a D1 (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 147 | pheophytin a D1 (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Site | 161 | Tyrosine radical intermediate | ||||
Sequence: Y | ||||||
Binding site | 170 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 189 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Site | 190 | Stabilizes free radical intermediate | ||||
Sequence: H | ||||||
Binding site | 198 | Mg (UniProtKB | ChEBI) of chlorophyll a PD1 (UniProtKB | ChEBI); axial binding residue | ||||
Sequence: H | ||||||
Binding site | 215 | a quinone B (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 215 | Fe cation (UniProtKB | ChEBI); ligand shared with heterodimeric partner | ||||
Sequence: H | ||||||
Binding site | 264 | a quinone B (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 265 | a quinone B (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 272 | Fe cation (UniProtKB | ChEBI); ligand shared with heterodimeric partner | ||||
Sequence: H | ||||||
Binding site | 332 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 333 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 337 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 342 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 344 | [CaMn4O5] cluster (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Site | 344-345 | Cleavage; by CtpA | ||||
Sequence: AS |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane-derived thylakoid membrane | |
Cellular Component | plasma membrane-derived thylakoid photosystem II | |
Molecular Function | chlorophyll binding | |
Molecular Function | electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity | |
Molecular Function | iron ion binding | |
Molecular Function | oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor | |
Molecular Function | oxygen evolving activity | |
Biological Process | photosynthetic electron transport in photosystem II | |
Biological Process | response to herbicide |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePhotosystem II protein D1 2
- EC number
- Short namesPSII D1 protein 2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Cyanobacteriota > Cyanophyceae > Synechococcales > Merismopediaceae > Synechocystis
Accessions
- Primary accessionP16033
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cellular thylakoid membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-31 | Cytoplasmic | ||||
Sequence: MTTTLQQRESASLWEQFCQWVTSTNNRIYVG | ||||||
Transmembrane | 32-53 | Helical | ||||
Sequence: WFGTLMIPTLLTATTCFIIAFI | ||||||
Topological domain | 54-110 | Lumenal, thylakoid | ||||
Sequence: AAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGG | ||||||
Transmembrane | 111-134 | Helical | ||||
Sequence: PYQLVVFHFLIGIFCYMGRQWELS | ||||||
Topological domain | 135-142 | Cytoplasmic | ||||
Sequence: YRLGMRPW | ||||||
Transmembrane | 143-161 | Helical | ||||
Sequence: ICVAYSAPVSAATAVFLIY | ||||||
Topological domain | 162-191 | Lumenal, thylakoid | ||||
Sequence: PIGQGSFSDGMPLGISGTFNFMIVFQAEHN | ||||||
Transmembrane | 192-218 | Helical | ||||
Sequence: ILMHPFHMLGVAGVFGGSLFSAMHGSL | ||||||
Topological domain | 219-270 | Cytoplasmic | ||||
Sequence: VTSSLVRETTEVESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRS | ||||||
Transmembrane | 271-295 | Helical | ||||
Sequence: LHFFLGAWPVIGIWFTAMGVSTMAF | ||||||
Topological domain | 296-360 | Lumenal, thylakoid | ||||
Sequence: NLNGFNFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLASGEQAPVALTAPAVNG |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 221-222 | Strong herbicide resistance. | ||||
Sequence: SS → LA | ||||||
Mutagenesis | 227-228 | Herbicide resistance. | ||||
Sequence: TT → AA | ||||||
Mutagenesis | 237 | Weak herbicide resistance. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 238 | Weak herbicide resistance. | ||||
Sequence: K → V | ||||||
Mutagenesis | 255 | Herbicide resistance. | ||||
Sequence: F → W | ||||||
Mutagenesis | 257 | Herbicide resistance. | ||||
Sequence: R → V | ||||||
Mutagenesis | 264 | Strong herbicide resistance. | ||||
Sequence: S → A | ||||||
Mutagenesis | 271 | Herbicide resistance. | ||||
Sequence: L → V, M, A, or S |
PTM/Processing
Features
Showing features for chain, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000090493 | 1-344 | Photosystem II protein D1 2 | |||
Sequence: MTTTLQQRESASLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEVESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADVLNRANIGFEVMHERNAHNFPLDLA | ||||||
Propeptide | PRO_0000316429 | 345-360 | ||||
Sequence: SGEQAPVALTAPAVNG |
Post-translational modification
C-terminally processed by CtpA; processing is essential to allow assembly of the oxygen-evolving complex and photosynthetic growth.
Tyr-161 forms a radical intermediate that is referred to as redox-active TyrZ, YZ or Y-Z.
Proteomic databases
Interaction
Subunit
PSII is composed of 1 copy each of membrane proteins PsbA, PsbB, PsbC, PsbD, PsbE, PsbF, PsbH, PsbI, PsbJ, PsbK, PsbL, PsbM, PsbT, PsbX, PsbY, PsbZ, Psb30/Ycf12, peripheral proteins PsbO, CyanoQ (PsbQ), PsbU, PsbV and a large number of cofactors. It forms dimeric complexes.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length360
- Mass (Da)39,721
- Last updated1990-04-01 v1
- Checksum2FE4088498A416C2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X56000 EMBL· GenBank· DDBJ | CAA39472.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X13547 EMBL· GenBank· DDBJ | CAA31899.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BA000022 EMBL· GenBank· DDBJ | BAA18230.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BA000022 EMBL· GenBank· DDBJ | BAA16586.1 EMBL· GenBank· DDBJ | Genomic DNA |