P15910 · PG095_FOWPN
- ProteinEntry-fusion complex associated protein OPG095
- GeneOPG099
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids243 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Biological Process | symbiont entry into host cell | |
Biological Process | virion attachment to host cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEntry-fusion complex associated protein OPG095
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Nucleocytoviricota > Pokkesviricetes > Chitovirales > Poxviridae > Chordopoxvirinae > Avipoxvirus > Fowlpox virus
- Virus hosts
Accessions
- Primary accessionP15910
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Virion membrane ; Single-pass membrane protein
Note: Localizes to the membrane surrounding the core of mature virus particles (MV).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-183 | Virion surface | ||||
Sequence: GAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANASAQLDAIVSAVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDECSAPPGQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTGND | ||||||
Transmembrane | 184-204 | Helical | ||||
Sequence: FSKYLYIIGGIICFLILLYYA | ||||||
Topological domain | 205-243 | Intravirion | ||||
Sequence: KKLFFMSTNDKVKVLLAKKPDVHWTTYIDTYFRSSPVLV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed; by host | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine; by host | ||||
Sequence: G | ||||||
Chain | PRO_0000099615 | 2-243 | Entry-fusion complex associated protein OPG095 | |||
Sequence: GAAASIQTTVTTINKKISEKLEQTASASATANCDINIGNIIFKKNKGCNVLVKNMCSANASAQLDAIVSAVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDECSAPPGQIMTFEFINTGTATGNCAMKSVLDVLTKSSDRVSGNQSTGNDFSKYLYIIGGIICFLILLYYAKKLFFMSTNDKVKVLLAKKPDVHWTTYIDTYFRSSPVLV | ||||||
Disulfide bond | 34↔57 | by OPG088 | ||||
Sequence: CDINIGNIIFKKNKGCNVLVKNMC | ||||||
Disulfide bond | 49↔136 | by OPG088 | ||||
Sequence: CNVLVKNMCSANASAQLDAIVSAVREVYDQLTEQQKAYAPSLLTAALNIQTNVSTITQDFETYIKQKCNSDAVINNIINVQSLEVDEC | ||||||
Disulfide bond | 116↔158 | by OPG088 | ||||
Sequence: CNSDAVINNIINVQSLEVDECSAPPGQIMTFEFINTGTATGNC |
Post-translational modification
Myristoylated.
Disulfid bonds are oxidized in the cytoplasm by OPG088 protein.
Unglycosylated because produced in viral factories instead of the classic ER -Golgi route.
Keywords
- PTM
Expression
Induction
Expressed in the late phase of the viral replicative cycle.
Keywords
- Developmental stage
Interaction
Subunit
Component of the entry fusion complex (EFC) composed of OPG053, OPG076, OPG086, OPG094, OPG095, OPG099, OPG107, OPG143, OPG104, OPG147 and OPG155. Except for OPG095 and OPG053, each of the EFC proteins is required for assembly or stability of the complex.
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 2-12 | Targeting to MV membrane | ||||
Sequence: GAAASIQTTVT |
Sequence similarities
Belongs to the orthopoxvirus OPG095 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length243
- Mass (Da)26,519
- Last updated2007-01-23 v4
- Checksum36B7CD3E8E3284B8
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 19 | in Ref. 1; BAA00225 | ||||
Sequence: S → C | ||||||
Sequence conflict | 30 | in Ref. 1; BAA00225 | ||||
Sequence: A → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D00320 EMBL· GenBank· DDBJ | BAA00225.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF198100 EMBL· GenBank· DDBJ | AAF44472.1 EMBL· GenBank· DDBJ | Genomic DNA |